CAZyme Information: MGYG000003607_01536

Basic Information

• Species: HGM04593 sp900770655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770655
• CAZyme ID: MGYG000003607_01536
• CAZy Family: GT90
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317	MGYG000003607_56|CGC1	37644.65	10.0466

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003607	1908641	MAG	Fiji	Oceania

• Gene Location: Start: 20248; End: 21201 Strand: +

Full Sequence      

MAQTPKFIYYIRANLLFVLPKCIHRWRMRRALQKAAKSPEREYLQSRVDYYNKLQKGTTL
PPDAPVLKEHTLKNKKSGSVYFYDSYEITRHFPDHLKWLLKGGDVTTVPEHPTIVKSRPI
EGDNANSILLKLNKVRHFIFVNDKIPFEKKEDLIIFRGDANGKPARIRFFEKWFGHPKCS
IIDTAKHSKNPEEWKGEKMSIEEHFKYRYIMALEGVDVATNLKWVMSSNSIAVMPRPTYE
TWFMEGKLIPNYHYIEIKPDYSDLMERIEYYNNHIDEAKAIIKNANEYAKQFRNKKREKL
LQLLVMEKYFKNTGQIF

Enzyme Prediction     

No EC number prediction in MGYG000003607_01536.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	142	296	3.7e-21	0.692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00672	CAP10	3.02e-16	142	291	75	231	Putative lipopolysaccharide-modifying enzyme.
pfam05686	Glyco_transf_90	5.42e-13	142	292	150	302	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSG83178.1	2.90e-108	3	316	11	321
QYS92068.1	1.66e-107	3	316	11	321
AUX18339.1	6.71e-107	3	316	11	321
QQT34018.1	2.15e-95	6	315	15	319
QLK45160.1	5.67e-92	6	315	5	312

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39907	5.38e-69	3	310	8	312	O-glucosyltransferase LpsA OS=Dichelobacter nodosus OX=870 GN=lpsA PE=3 SV=1
Q6UW63	6.02e-09	146	290	297	444	Protein O-glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POGLUT2 PE=1 SV=1
Q9JHP7	1.08e-07	146	290	297	444	Protein O-glucosyltransferase 2 OS=Mus musculus OX=10090 GN=Poglut2 PE=1 SV=1
Q566E5	3.40e-06	189	309	350	469	Protein O-glucosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Poglut3 PE=2 SV=1
Q7Z4H8	4.53e-06	189	309	349	468	Protein O-glucosyltransferase 3 OS=Homo sapiens OX=9606 GN=POGLUT3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003607_01536.