CAZyme Information: MGYG000003607_01543

Basic Information

• Species: HGM04593 sp900770655
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770655
• CAZyme ID: MGYG000003607_01543
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		36914.09	6.5041

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003607	1908641	MAG	Fiji	Oceania

• Gene Location: Start: 28414; End: 29400 Strand: +

Full Sequence      

MKKISKISIAASLVLVIAVAVFTNAETPQKDGGVVVETEPIQRSPYDIVPPAIPKNVVFA
GEEIDLTQQDRRERMDREMLSFCYSHINTTLQLKRANRLFPIVEPILRECGVPDDFKYLM
IIESNGDIEARSPAGAGGLWQFMEATGKEYGLEINGEVDERYNIEKATRAACRYLKESYR
EFGDWLTVAASYNTGRANVKKRIDAQNQTKAIDLVLLPETSRYIFRLLAVKTIFEKPSDY
GFILQSSDLYPTIPTNSVAVDSSIVSWAVFAQQYGLTYLQLREINPWIRGKALTNRSGKN
YSVLIPVSGALNYNPDNTTAHNENWVTK

Enzyme Prediction     

No EC number prediction in MGYG000003607_01543.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	103	231	9.5e-21	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	3.19e-60	107	231	1	128	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam01464	SLT	1.80e-22	113	214	12	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.35e-18	119	229	7	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10783	mltD	1.19e-17	102	306	108	311	membrane-bound lytic murein transglycosylase D; Provisional
cd16896	LT_Slt70-like	8.78e-14	123	224	29	137	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT70157.1	9.56e-116	1	326	1	324
BCA49012.1	1.21e-115	1	326	8	331
ALJ43129.1	1.35e-115	1	326	1	324
QMW86815.1	1.71e-115	1	326	8	331
AAO79592.1	1.71e-115	1	326	8	331

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.43e-21	59	306	62	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.43e-21	59	306	62	308	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.016173	0.852556	0.130424	0.000286	0.000268	0.000267

TMHMM  Annotations     

start	end
7	24