CAZyme Information: MGYG000003610_01320

Basic Information

• Species: HGM04593 sp900770665
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04593; HGM04593 sp900770665
• CAZyme ID: MGYG000003610_01320
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000003610_68|CGC1	83837.18	4.9104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003610	2461139	MAG	Fiji	Oceania

• Gene Location: Start: 10768; End: 13038 Strand: +

Full Sequence      

MANKNIETVAVGSLLQSTAWYRELAATAECEYLLLVGKEGVSVDDMLLNDMLLAMPADAV
MGYSHYRKKIDGNVSDAPTIDWQPGSLRNDFDFGPVLLFRSNALKQYLEMSLDEYDFAGF
YQLRLAMERIGAIYHHCEYVYTVDEDDTRKSGEKQFDYVNPAQRNVQIEMEQVCTHHLKQ
VGAWLPPCKYDAIDLSAGEFPVEASVVIPVLNRESTIADAITSVLRQKCTFTFNILVVDN
HSTDRTPQIIDSFADERVVHIIPSCNDLGIGGCWQLAVDDARCGRFAVQLDSDDIYSDEN
TLQRVVDGFYQQQCAMLIGTYRICDFELNTLPPGIIDHREWSEENGRNNALRINGLGAPR
AFFTPVIREIGFPNVSYGEDYAVGLQISRRYKIGRIYDVLYLCRRWGGNSDAALSHEKVN
AHNFYKDSLRSAELAARQALVSSWGTVSREGVDAFFEKQLAQWPDAAKRYEALSATRQRV
FGNGVSLQYNPSRAVSTAAKVDAASIAGRPCFLCAGNRPAEQISENALGSLELLVNPYPI
LPQHFTLPLKRHIPQVLEPMYADMLHLAGRWQGLAVFYNGAKCGASAPDHAHLQAVRCCD
VPLLKSVTAGDLSFGEPVCVVGDASLYNVKGYVVPFFVLTSGNVSHSVELFNRLLAAMPV
VEGEPEPRMNVISYYSATEGYVTVVIPRAQHRPACYYAEGALQRLVSPGTLDMAGLIVTP
RECDFEGITSDEATALLREVAVSDDVACSIIEKLKM

Enzyme Prediction     

No EC number prediction in MGYG000003610_01320.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	205	335	6.6e-20	0.7588235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	7.95e-80	561	745	2	185	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
pfam00535	Glycos_transf_2	2.03e-17	205	363	1	157	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	9.35e-17	205	299	6	99	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	2.08e-16	206	324	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	7.73e-14	205	411	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16693.1	2.33e-261	8	755	52	803
QUB46036.1	3.81e-258	12	755	58	798
QUB92198.1	3.03e-257	11	755	57	798
QUB62779.1	3.40e-256	12	755	58	798
QUB76439.1	1.36e-255	12	755	58	798

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003610_01320.