CAZyme Information: MGYG000003611_00002

Basic Information

• Species: HGM04792 sp900770705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04792; HGM04792 sp900770705
• CAZyme ID: MGYG000003611_00002
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		45343.19	7.0142

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003611	1994731	MAG	Fiji	Oceania

• Gene Location: Start: 520; End: 1752 Strand: -

Full Sequence      

MGVLLCLFCLFSCKEKSEKADNAAFQTAPAATSGGDFDHIVESGELIVATLSGPDTYFDY
HGTPFGLQYALAADFARTEGIRLRVELATDTAALCEMLQKGEADIAVLQLPMAEIGRWKL
AGAGAADRKAGTSWAVLAENTQLAEALDAWYGVGVEVTAQRTEQTRMKQRRTIRRKVRAP
YISREKGIISTYDDLFRQAAATTGWDWRLIAAQCYQESGFDPNAVSYAGAKGLMQLMPAT
AAHLGVGEADIFTPSHNVGGAARLIRELTATFSDIRDRSEKIKFVLAAYNGGAAHIRDAQ
ALARKYGKNPCRWSDVREYVLALQQPRYYRDPVVRNGYMIGSETYAYVEAILQRWRDYGG
QLPAATILPQDHYVQPQTGGEGQQPAPRRRNRFTKNTRIYDADDPEFITD

Enzyme Prediction     

No EC number prediction in MGYG000003611_00002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	203	355	9.8e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	1.92e-77	196	358	1	159	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	7.94e-50	3	351	16	443	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	3.65e-44	35	392	14	461	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
pfam01464	SLT	7.96e-24	196	309	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13401	Slt70-like	8.67e-21	192	320	6	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28026.1	1.24e-101	3	364	32	391
VEH15587.1	2.30e-101	4	360	39	396
QUB48180.1	3.64e-101	1	367	7	373
ALO48082.1	4.99e-101	4	360	9	365
EFC70077.2	1.65e-99	3	394	6	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OZ9_A	1.97e-22	192	351	259	414	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with isoleucine [Pseudomonas aeruginosa PAO1]
4OYV_A	2.09e-22	192	351	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with leucine [Pseudomonas aeruginosa PAO1]
4OWD_A	2.09e-22	192	351	266	421	Crystalstructure of MltF from Pseudomonas aeruginosa complexed with cysteine [Pseudomonas aeruginosa PAO1],4OXV_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with valine [Pseudomonas aeruginosa PADK2_CF510],4P0G_A Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide [Pseudomonas aeruginosa PAO1],4P11_A Native crystal structure of MltF Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
5AA4_B	2.35e-22	192	351	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA4_A	2.35e-22	192	351	252	407	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SNZ5	6.36e-29	181	356	282	451	Membrane-bound lytic murein transglycosylase F OS=Aeromonas salmonicida (strain A449) OX=382245 GN=mltF PE=3 SV=1
A8ZWR8	1.98e-28	195	352	289	442	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2
A0KJ50	2.21e-28	181	356	282	451	Membrane-bound lytic murein transglycosylase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=mltF PE=3 SV=1
Q30PQ0	1.13e-25	181	351	282	448	Membrane-bound lytic murein transglycosylase F OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=mltF PE=3 SV=2
Q0VRG6	2.10e-25	192	351	288	443	Membrane-bound lytic murein transglycosylase F OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000282	0.020710	0.978981	0.000012	0.000017	0.000011

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003611_00002.