CAZyme Information: MGYG000003611_00344

Basic Information

• Species: HGM04792 sp900770705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; HGM04792; HGM04792 sp900770705
• CAZyme ID: MGYG000003611_00344
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
740		82534.73	9.7104

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003611	1994731	MAG	Fiji	Oceania

• Gene Location: Start: 17058; End: 19280 Strand: +

Full Sequence      

MKCSCRSRIGWGLAALSLCLLWWLVPPSWERQSRAVVLVESRTHYRLALADGTEVDFLPP
MADSTLAVDAELQRTTTGFLIAADGRLITSAAAIAQLPDSLCGEALQAALQARRENLQRR
RTTLKANQKELEYYARTHTITDDGYNDVMEWRYRTEVDIRRTDSLLQRLEAALALPAAVA
YRQNTFRVVQTVPTTGDSVQTSACSATLLGAVGEDLLLLRLRGEALPESATTISTLSALP
ALLTPARAPRRVVTFFQTAADDTTGGYMPPTVAELSDSCSHLLPTAAEGSPVFNRMGQLT
GVIANGKCLSARRLWRVSGKGEPWLKAKAAAVKRWWHRLPADTAACRRPAAEWRPNVAGR
WTPGREIQHRKLSDATYYGYVKNGKPEGFGVALLANGSRYEGYWKSGLRSGFGALRDTSG
VEFRGMWERDTLRRGVAVSGTYVYAGSFDDRSRPHGFGIVYSCDATFCYLGEWNYGLREG
HGFGMSTGKLVQCGHWSGGNYKGEQMRYTADRVYGIDISRYQHEIGKKKYSIDWKKLRIT
SLGSSNSGRIVGRADYPVSYVYIKSTQGVTIRNRYYPADLRQARAHGLPVGAYHFFSTNR
SGAAQADFFLKHSGIRRGDLPPMLDVEPSEAQISQMGGDKALFREVLAFLRAVERACGVR
PVLYVGQQFVNRHIPNAPDELTDYDVWVARYGQYRPYVHLLHWQLSPHGRVTGIRGEVDI
NVFNGTKEQFREYLRTHCVK

Enzyme Prediction     

No EC number prediction in MGYG000003611_00344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	516	714	3.8e-37	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	1.41e-49	514	725	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	2.34e-42	513	725	3	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	9.67e-42	514	723	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	4.88e-34	516	714	1	180	Glycosyl hydrolases family 25.
COG3757	Acm	7.76e-31	513	728	63	258	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48884.1	1.56e-106	430	739	94	402
AGB29361.1	1.81e-104	357	734	32	407
BBA29745.1	2.17e-103	431	738	271	575
VEH15425.1	7.27e-103	431	733	67	374
QNT67810.1	1.22e-102	431	740	41	353

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	8.91e-19	513	733	16	216	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
4KRU_A	1.98e-18	558	730	42	212	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.43e-17	558	730	42	212	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
1JFX_A	4.25e-15	513	726	5	205	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P76421	1.75e-27	513	734	67	265	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	1.75e-27	513	734	67	265	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
Q8FFY2	4.37e-27	513	734	67	265	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P26836	5.41e-16	509	736	5	213	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2
P25310	8.18e-14	513	726	82	282	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.883754	0.113268	0.001707	0.000342	0.000238	0.000703

TMHMM  Annotations     

start	end
7	26