CAZyme Information: MGYG000003612_01167

Basic Information

• Species: Succinivibrio sp900770725
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp900770725
• CAZyme ID: MGYG000003612_01167
• CAZy Family: GT2
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	MGYG000003612_45|CGC1	80982.48	8.5363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003612	2641191	MAG	Fiji	Oceania

• Gene Location: Start: 6132; End: 8279 Strand: +

Full Sequence      

MKHFSETVLLVLVVLPIMYVMIVTPMTAEHQFVFGLCMIASCFVLSNISSRHVVSVILIL
VSVTMSTRYMYFRLTQTLVFTSLVEAICGYILFLAECYVYIILLLSSFQISWALKRDVVP
MPRDISKWPTVDVYIPTYNESLSIVRDTVLAAQCLEYPQDKIKVYLLDDGRRKEFAQFAT
EAGVGYITRSDNAHAKAGNLNHAMKLTHGELIAIFDCDHIATRMFLQDTVGAFLTDPKLA
LIQTPHHFYSPDPIQRNLYLGRDIPAENELFYGPVQRGNDNWDAAFFCGSCAVIRRKALD
EIGGFAVETVTEDAHTALRLQRRGWKTAYLNKILAAGLATERTILHIIQRNRWARGMIQI
LRLDNPLFGRGLTFAQRLCYLSATMYFLFALPRVVFLVIPSLYLVFGISVLHGSAAILLA
YAIPHLFMSYYTSSRVNGRSRYSFWGEIYDILLSFPLVIPTLAVLISPRHGKFNVTDKGG
TIDKAYFDAHAVRAHIICAIFLVFSIAFGIAKYFMPQYFNVQLSAVLLNIGWAVFNLTLL
TAAICVARETPNKRKAQRLEMDIPVLIYQESGICSRSTMRDISMTGCRIDNVLGDMMLAE
DPVTDLELATDHGPVNLRVSMIGNSAFSDYLRFDFGEVDINTRRELVRLMFTRPDTWARK
PYKQDNIIVSYFTVLACIWDSLTSNRKQRRKNKNKEKPAETVEDAVKKDASEGIA

Enzyme Prediction     

EC	2.4.1.12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	132	303	4.5e-35	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03030	CelA	0.0	22	676	25	696	cellulose synthase catalytic subunit (UDP-forming). Cellulose synthase catalyzes the beta-1,4 polymerization of glucose residues in the formation of cellulose. In bacteria, the substrate is UDP-glucose. The synthase consists of two subunits (or domains in the frequent cases where it is encoded as a single polypeptide), the catalytic domain modelled here and the regulatory domain (pfam03170). The regulatory domain binds the allosteric activator cyclic di-GMP. The protein is membrane-associated and probably assembles into multimers such that the individual cellulose strands can self-assemble into multi-strand fibrils.
PRK11498	bcsA	0.0	17	676	149	804	cellulose synthase catalytic subunit; Provisional
cd06421	CESA_CelA_like	2.68e-120	129	361	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
COG1215	BcsA	1.21e-55	89	543	13	430	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.69e-34	133	362	2	233	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJT83155.1	2.02e-286	7	690	6	688
ANI80775.1	2.87e-286	7	690	6	688
AEN66928.1	7.35e-286	8	704	7	698
QMR75732.1	1.04e-285	8	704	7	698
ABP62595.1	3.93e-285	8	693	7	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	1.02e-177	25	675	170	816	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	4.29e-109	68	589	67	605	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.55e-108	68	589	79	617	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.61e-108	68	589	80	618	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	2.85e-11	112	326	22	235	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59167	7.44e-186	23	678	43	696	Cellulose synthase 2 OS=Komagataeibacter hansenii OX=436 GN=acsAII PE=3 SV=1
Q9WX61	1.01e-185	26	678	47	697	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
P19449	2.71e-182	26	698	47	726	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
Q9WX75	2.11e-181	54	658	71	674	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1
Q9RBJ2	2.11e-181	54	658	71	674	Putative cellulose synthase 2 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-A PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
39	61
82	104
378	397
402	424
444	466
491	510
525	547