CAZyme Information: MGYG000003614_01502

Basic Information

• Species: Prevotellamassilia sp004552865
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp004552865
• CAZyme ID: MGYG000003614_01502
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42748.89	8.3859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003614	1915631	MAG	Fiji	Oceania

• Gene Location: Start: 4414; End: 5550 Strand: -

Full Sequence      

MKYFLIAGEASGDLHAAHLMMALKQEDAEADFRCYGGDEMEAAGGGLLCHHRHLAYMGFI
PVLLHLPTILRGMKRCKEEIAAWKPDAVILVDYPGFNLKIAAYVKEKGICPVFYYISPKI
WAWKEHRIHAIRRHVDRMFSILPFEKDYFEKKHGYEVSYVGNPTVDEVAEFLRQHSHCEK
SEQTIALLPGSRKQEIKDNLSRMLQAVAPLTKDYRVVIAAAPSIPEDFYLQILRNSPLPS
EACRLEKGRTYHILHQASAALVTSGTATLETALFRVPQVVCYYIVCGTFVSWLRRHLLKV
PFVSLVNLVCGKEVVKELVADSMTPQRVRAALSEILPGEAKREQMLADYETMARILGEPG
APQRAAKEMVERLKRSVV

Enzyme Prediction     

No EC number prediction in MGYG000003614_01502.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	5.4e-114	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.97e-112	1	376	2	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.36e-102	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.23e-78	4	343	2	346	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	7.83e-68	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.41e-46	1	326	2	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77942.1	9.69e-156	1	375	1	378
AKA50816.1	9.00e-149	1	375	1	377
QUT69712.1	1.32e-148	1	375	1	378
QUT41873.1	1.87e-148	1	375	1	378
BCA48556.1	2.66e-148	1	375	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.45e-40	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.64e-40	5	371	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.03e-75	2	373	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	2.34e-67	5	376	8	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	3.39e-63	2	370	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	3.39e-63	2	370	10	379	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q6ALW0	7.28e-63	2	366	11	379	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999994	0.000048	0.000005	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003614_01502.