CAZyme Information: MGYG000003615_00780

Basic Information

• Species: CAG-791 sp900315055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp900315055
• CAZyme ID: MGYG000003615_00780
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
701	MGYG000003615_42|CGC1	80349.08	6.2855

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003615	3081888	MAG	Fiji	Oceania

• Gene Location: Start: 11370; End: 13475 Strand: -

Full Sequence      

MLKKMIQERLVKGREEQYRKDLASKQNAYAAWYRPHTFELKRQIEAADHTKGNALSLEVV
RYSHLRSYILGEKRKMPDIIVACDDDGNVTDYAEQMIRDFFAEHEDISFVYGDEDRIDED
GQLRDPWLKPDWSPDTFLSTFYIGDIFAFRSSELAMINPGGRVASDIEARQKLEADAEEE
KNAAKTDLDDPMRSWIYGKLCMRLLQAEGGFTRRSGDVFDFPVGHIREILFHASRKPEPW
NSNLIRGSLTGRFSSESAATRLISIIIPSKDNPKVLATCIHSIEKYTENSPYEIIVVDNG
SSPENQVQVRRLLKAHDDAQGAARYIYAPMEFNFSRMCNLGANAANGELLLFLNDDIEIR
AKGWLSYLSEKAKLPYVGCVGMKLLYPNSDMIQHAGVVNVHAGPIHKLQYCSNKEEHYFG
YNKGVRNVIAVTGACLMLKASLFREVGGFDEENFAVAFNDIDLCLSVYEKGYYNVVRNNM
YLYHHESLSRGDDRKDKIKAQRLSKEQERLLSRHPKLFLRDPFYHPYLNQDPAVKEFSIA
VEDVELRNPHYTKPEKVEKAFPEKWTDPVLKLGVEYADSLDRWLTGPLTDAAGRAEINKG
YYIKGYAFVINANQAVYDRKVLLKAEDGTIYEMDSETAYRPDIAQNLTDQINDRLTGFWT
ILKNDALPKGKYLIGMLAIDRTSRQRLVNWSDVELKVREGY

Enzyme Prediction     

No EC number prediction in MGYG000003615_00780.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	264	446	1.4e-17	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.70e-31	265	486	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.51e-22	263	492	5	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.94e-14	264	390	1	121	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd04184	GT2_RfbC_Mx_like	1.58e-13	101	152	108	159	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd06423	CESA_like	9.67e-13	265	455	1	178	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOZ95571.1	5.37e-151	1	699	1	703
ADL33298.1	3.82e-148	1	690	1	695
QNM02107.1	8.15e-111	6	689	7	659
QWT52131.1	2.32e-89	107	672	509	1032
QUF73846.1	6.66e-88	103	677	808	1341

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.36e-43	104	528	476	888	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.84e-35	101	493	426	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003615_00780.