CAZyme Information: MGYG000003615_01718

Basic Information

• Species: CAG-791 sp900315055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp900315055
• CAZyme ID: MGYG000003615_01718
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000003615_90|CGC2	83095.73	4.5157

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003615	3081888	MAG	Fiji	Oceania

• Gene Location: Start: 28100; End: 30406 Strand: +

Full Sequence      

MKRFGTRLVLCSLTASMLFSGTALAAAPQWSAGNVYVAGNEVTYDGDTYRARWWSQNEVP
GSSAWGAWEKVTKETAETPEDPGSSQTPDPSTTPEAPASGVPAWDASAVYTGGMKALYNG
STYEARWWVTGEKPDSSDAWKKIGSSGETPETPETPVQPSEPEKNTAPVLSGVKDTVEVS
VGDTIDVLSGITATDAEDGDLTGKVRVTGSVDTGTAGTYVVTYTVTDSRGESASAKTTFV
VREKETMNTAPVLSGVKDTVEVSVGDSVDVLSGITARDAEDGDLTGKIKVTGAVDTGTAG
TYVITYTVTDSKGESASAKTTFTVNKKETETPVDPDHSEPPVPFWKDYKNYPAKNTQVYY
RGRVYQNKWYANAGTKPDSGDPWVLVGDAEWTVAEKDSNYTKESSGKGSGSGTAETVFDK
VLTDSEIQELYGGINPAYSPEAAVNRLGALIPKKAYEELFPYRFGSPKWKACAATRQYYS
DPSKYPDYYSYENLQEAVHTLANTVIKVQWYEGATWCYRLIRLNKTTKEQKLIYSDPNFD
AEWLQTKPLCTSICDYGSFLAEGDLNTRKRELAGFLANISHETGGGSVDGTIDDSLTGLY
FNEEVGFIGSSQIGYVQSSGTKYLPAAGKSYHGRGPIQLSYNYNYGLCSDVLYGDSSILL
NDPDRLEQDGVLGFMTGIWFWMTPQPPKPSCHQVITGTWAPKEGAANASYNGNFGLTIVI
INNEAGQSENGSGAVARRSRYYRIFAGRMGADISGEHVDTMGMTTFTQ

Enzyme Prediction     

No EC number prediction in MGYG000003615_01718.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	549	758	2.9e-54	0.8311688311688312

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	6.05e-70	547	760	24	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	8.26e-46	559	759	40	231	Chitinase class I.
pfam16403	DUF5011	8.01e-15	258	324	7	71	Domain of unknown function (DUF5011). This small family of proteins is functionally uncharacterized. This family is found in Bacteroides, Prevotella, and Parabateroides. Proteins in this family are around 230 amino acids in length.
pfam16403	DUF5011	1.23e-14	175	238	7	68	Domain of unknown function (DUF5011). This small family of proteins is functionally uncharacterized. This family is found in Bacteroides, Prevotella, and Parabateroides. Proteins in this family are around 230 amino acids in length.
cd12215	ChiC_BD	4.33e-14	28	70	1	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX42311.1	2.34e-222	336	768	40	464
AJS59770.1	1.03e-92	392	766	162	549
SYX81768.1	2.81e-91	420	766	202	547
AJS58806.1	2.08e-81	410	766	66	424
QTH45557.1	6.10e-81	393	766	43	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6LNR_A	1.19e-32	558	766	95	292	Structureof intact chitinase with hevein domain from the plant Simarouba glauca, known for its traditional anti-inflammatory efficacy [Simarouba glauca]
3CQL_A	2.29e-32	556	766	41	242	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
1DXJ_A	5.62e-32	551	745	36	220	Structureof the chitinase from jack bean [Canavalia ensiformis]
7V91_A	8.25e-32	556	745	41	222	ChainA, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V92_A	5.23e-31	556	727	41	206	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q688M5	2.29e-33	549	750	118	311	Chitinase 9 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht9 PE=2 SV=1
Q05538	1.11e-32	551	766	107	313	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1
P52405	1.87e-32	556	766	108	309	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
P86473	5.11e-32	556	761	112	322	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2
P52404	8.26e-32	556	766	106	307	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000289	0.998920	0.000194	0.000220	0.000183	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003615_01718.