CAZyme Information: MGYG000003615_02369

Basic Information

• Species: CAG-791 sp900315055
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-791; CAG-791 sp900315055
• CAZyme ID: MGYG000003615_02369
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000003615_131|CGC1	45465.67	5.0227

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003615	3081888	MAG	Fiji	Oceania

• Gene Location: Start: 5925; End: 7130 Strand: +

Full Sequence      

MPQETQQQQDAAALLLPYVDTVLENSDAGHPYWNREVIRSGEENRWNYIDGCMIRGILEL
YSITGKEKYLTFADRYVGDFVQEGGSVRTYCLEDYTLDNINGARNLFLLYEKTGKEKYRK
AMDLFRSQLDTQPRTFEGSFWHKKIYPDQVWLDGIYMAMPFYAQYEVVCRRCGMVSRSIK
GTGIEDVCRQIELVGERMRDPKTGLYYHGYDASRRMYWADKETGCSSCFWLRAIGWFILG
LADVLEILQDLPEYQAHAEKIAAMFRDLAGALLPYQDPSGLFYQLVDRKDLPGNYLESSG
SALVAAALLKGARLGFLKEDLKKAGERCFEGLVRERLTRGEDNELHLTGICLVAGLGGVT
HRDGSPAYYLSEPVVDDDAKGIGPLLLAFTERLRTEGGLNG

Enzyme Prediction     

No EC number prediction in MGYG000003615_02369.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	393	2.3e-100	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.19e-98	34	396	21	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	6.40e-91	36	395	17	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.002	53	127	473	566	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL35233.1	9.92e-155	14	396	9	380
AXB29657.1	3.49e-138	9	393	4	378
CBL00657.1	4.95e-138	9	393	4	378
AXA82451.1	1.41e-137	9	393	4	378
VCV21981.1	5.34e-136	18	396	7	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.45e-98	44	391	21	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.79e-67	44	391	37	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	7.52e-67	44	391	27	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3PMM_A	1.19e-17	46	341	66	338	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	9.81e-67	44	391	37	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.06e-47	157	393	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.06e-47	157	393	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	7.24e-22	46	314	29	274	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003615_02369.