CAZyme Information: MGYG000003617_00259

Basic Information

• Species: Helicobacter_D sp900770765
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D sp900770765
• CAZyme ID: MGYG000003617_00259
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408	MGYG000003617_25|CGC1	47885.83	10.0755

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003617	1743156	MAG	Fiji	Oceania

• Gene Location: Start: 7208; End: 8434 Strand: +

Full Sequence      

MDFTQNKKYKFGILLAATSDSIFTLGTMIANIYAIMGECVDVFYIVSDKILPSDKVALQK
VARDIEIKFIPFTKEIFENNFIEFANANKEELREFLKAQNAFLRRWSYMVYACFEAFKYL
GECERILYLDFDILLLRTLSHLSRVKEGFALHKGRTKISHNAPLYEGEFRKYPVYRSGII
LFTQALANPLESLKSCYKNSFKYKMISDQVAISLLIYENKIKVKNLSYKYTGLPHFRSND
NPYLIHAYGSNNRFWNNRLCNRLFPSWNLYYKEWLESGGSAYKGGFVANTTNSYERFRYH
LSYKLGYAIVKNHTFPKALKLLFLLPYITLKHKIQILRYKNLIKKKPFLKLPPLVTYDDY
NRGILEKNSISYRLGSALLEVFKGGNIFSNFMRFCRQSKAIYKNKLES

Enzyme Prediction     

No EC number prediction in MGYG000003617_00259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	12	256	6e-16	0.867704280155642

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	7.14e-07	13	142	3	115	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	6.81e-05	13	142	5	117	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	9.16e-05	58	142	21	118	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJD03204.1	2.61e-97	8	405	2	399
ACM63971.1	1.47e-96	8	405	2	399
QKF75239.1	1.47e-96	8	405	2	399
QOQ99922.1	4.16e-96	8	405	2	399
QIA16190.1	8.32e-96	8	405	2	399

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.997372	0.002310	0.000027	0.000007	0.000006	0.000304

TMHMM  Annotations     

start	end
13	35