CAZyme Information: MGYG000003617_01439

Basic Information

• Species: Helicobacter_D sp900770765
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D sp900770765
• CAZyme ID: MGYG000003617_01439
• CAZy Family: GT111
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		70185.94	9.0294

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003617	1743156	MAG	Fiji	Oceania

• Gene Location: Start: 107; End: 1906 Strand: +

Full Sequence      

MRDFKDGEAYFNFSDFSKYFWSRSDSKKLKEMVDSDKFDIILNMPVKLKESVKEQYQSRI
ALSEGHIASDIETMENIINSDFPHLSDEFRAYINGSESYFTNMFIMRKNVFFEFCEIVFP
ILFKYHQSIDYSNRNVFQQRMFISERVAGMAYGVLKRKYSWTHLPVSVVFNTSSLEEIKP
AFKDSVAICASVDEFYLPYLFVMIDSLLKNANRDYKYEIYILHTSINVESQNKFLSYFKD
LNVCVKFINVATLIGEQKFNNISFYTSNHIKEATYYRFFIPNLFKDFEKILYLDADMLVL
SDISTLFFTDLGDNYLAAAKDYGIEYNLKSGNEHFKNYQLKTLEMKNPHNYFQAGCILYD
IKKCLEIGFTDICLNALAKIKKPLLHDQDVLNSAFEGKVLNLELNWNYTWNIPIVFPNYS
KYLSTSDIAKINEAKNNPYIIHYCDHIKPWNLPHLPKASLWWEYARKTPYYEEILFNQIK
SVESQKKCGAIARVKNQLSYKIGAKILQAKSALNAIKLPFAILYLIAQHKIDLARYNSSL
RINPTLKQPRLESYADYAEALKAKNHLSYRLGNALLKNPLTFLFKALKIYKDFKRSQKC

Enzyme Prediction     

No EC number prediction in MGYG000003617_01439.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	179	451	1.2e-57	0.8988326848249028
GT111	10	148	5e-24	0.6221198156682027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04194	GT8_A4GalT_like	1.36e-61	186	451	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
COG1442	RfaJ	2.56e-42	187	488	4	285	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01501	Glyco_transf_8	2.54e-38	193	451	7	249	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	3.27e-21	185	452	2	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd02537	GT8_Glycogenin	4.59e-13	274	466	78	238	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASN92820.1	1.16e-134	70	597	173	712
ASQ29972.1	1.22e-113	13	597	142	727
ASE90677.1	1.36e-109	186	597	383	791
ABV52939.1	1.36e-109	186	597	383	791
AXL32980.1	1.43e-109	70	527	173	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	3.25e-45	70	484	182	602	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	7.95e-14	191	451	6	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
1G9R_A	3.46e-13	191	451	6	253	ChainA, GLYCOSYL TRANSFERASE [Neisseria meningitidis],1GA8_A Chain A, GALACTOSYL TRANSFERASE LGTC [Neisseria meningitidis]
5GVV_A	1.25e-12	269	465	82	251	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVW_A	1.25e-12	269	465	82	251	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25148	7.11e-25	183	451	3	256	General stress protein A OS=Bacillus subtilis (strain 168) OX=224308 GN=gspA PE=1 SV=2
P43974	1.75e-17	183	451	36	279	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2
A0A0H2URH2	2.69e-17	187	464	4	244	Glycosyltransferase GlyF OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyF PE=3 SV=1
A0A0H2URJ6	6.83e-12	269	465	82	251	Glycosyltransferase GlyE OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyE PE=1 SV=1
A0A0H2URH7	1.71e-11	262	464	369	541	Glycosyltransferase GlyA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003617_01439.