CAZyme Information: MGYG000003618_01491

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000003618_01491
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
308		34568.93	5.6164

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003618	1816095	MAG	Fiji	Oceania

• Gene Location: Start: 139; End: 1065 Strand: +

Full Sequence      

MLDFDGYQIDQLGYRGDRYDYYGVKVNLPQAYGKFIAYMKNLHPGKRLVMNSVGSYGAQN
IASSGCVDFCYNEMWDQEAEFKSLHDVIRANDTYSNHSLRTVFAAYMNYGKSGSKGEFNT
PGVLLTDAVMFALGGSHLELGDHMLGSEYFPNNNLSMPQELRTGIIRYYDFMTAYENLLR
GTDTSSEVATAITCTDPSLKLTFSAWPPKQGNIVTYSRNVGNSRVINLLNFRNVDDMSWR
DYNGDRRAPALALDIPVSVTVSTPVTRVWVATPDYHGGAVQELAFTLSGNTLTFTVPQLR
YWTMIVIE

Enzyme Prediction     

EC	3.2.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	2	308	2e-99	0.5449640287769785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13199	Glyco_hydro_66	3.36e-146	2	306	250	557	Glycosyl hydrolase family 66. This family is a set of glycosyl hydrolase enzymes including cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.-) and dextranase (EC:3.2.1.11) activities.
cd14745	GH66	1.43e-82	2	175	156	331	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT36786.1	8.31e-135	2	308	294	601
QPH57258.1	4.72e-134	2	308	294	601
QUT99422.1	6.29e-134	2	308	292	599
QBJ17000.1	6.29e-134	2	308	292	599
QUT68069.1	1.89e-133	2	308	294	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AXG_A	1.59e-55	1	308	303	609	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXG_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223]
5AXH_A	1.61e-54	1	308	303	609	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXH_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223]
3WNL_A	2.03e-23	116	305	510	700	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	2.03e-23	116	305	510	700	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNK_A	2.05e-23	116	305	529	719	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70873	6.14e-24	3	305	293	728	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P94286	1.25e-22	116	305	546	736	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
Q54443	1.86e-13	28	308	409	733	Dextranase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=dexA PE=1 SV=2
P39653	3.75e-13	4	308	448	801	Dextranase OS=Streptococcus downei OX=1317 GN=dex PE=1 SV=1
Q59979	1.19e-09	2	308	239	598	Dextranase OS=Streptococcus salivarius OX=1304 GN=dex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003618_01491.