CAZyme Information: MGYG000003618_01520

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000003618_01520
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
168		18027.01	9.745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003618	1816095	MAG	Fiji	Oceania

• Gene Location: Start: 12; End: 518 Strand: +

Full Sequence      

MDAVARQFPQYTIVVAGAPGIPDEFYKGLTKFSVVRDATHNLLAVSHAALVTSGTATLEA
ALAGVPQVVTYRSNGSRIAYSLMKKLLHVKHVSLPNLIVGDTIIPEMLLHLCTPEAVTEQ
LAAICPDNAPARRAQLQGYADMRQRLGGPGAAMRAANIITTRLKELKQ

Enzyme Prediction     

No EC number prediction in MGYG000003618_01520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	146	3.1e-33	0.3983050847457627

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.37e-39	26	159	243	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	9.54e-34	34	159	253	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.23e-21	7	122	216	336	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	3.84e-14	23	116	214	308	lipid-A-disaccharide synthase.
PRK01021	lpxB	0.001	49	121	492	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	1.75e-38	1	168	211	379
QQR08529.1	2.54e-36	1	159	211	370
ASB37800.1	2.54e-36	1	159	211	370
ANU64105.1	2.54e-36	1	159	211	370
BCI64292.1	9.99e-36	5	168	214	379

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	5.15e-08	43	146	265	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	5.15e-08	43	146	265	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.67e-18	34	165	252	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	5.55e-17	4	159	217	374	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B3E4H8	2.46e-15	33	165	253	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q2IL69	2.46e-15	34	156	256	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1
B8JE78	4.61e-15	34	156	256	375	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003618_01520.