CAZyme Information: MGYG000003621_00923

Basic Information

• Species: Succinivibrio sp003456415
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Succinivibrio; Succinivibrio sp003456415
• CAZyme ID: MGYG000003621_00923
• CAZy Family: GH8
• CAZyme Description: Minor endoglucanase Y

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335		37843.87	5.8078

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003621	1983527	MAG	Fiji	Oceania

• Gene Location: Start: 200; End: 1207 Strand: +

Full Sequence      

MMLKKFIKSLSVGTLVALSISSQSFASAWDDYKAKYLQQDGAIVDTGNNNMSHSEGQGYG
LMFALAYDDKESFEKILNWTNQNLKDPKSGLFYWSYRRDGSDPIPDKNNATDGDLFIAWT
LIKAGKKWQNKAYLKQGETLANLVTTLTATKVGGYNVVLPGVSGFFYDNYVVVNPSYFIY
PAFKDLANYTYIKLWKELSSDGKKLLNNLSGQKIKLAPDWLELHADSTNLPAPQWPSRSS
YDAIRVPLYLYWADPNCPELQVYKTYYASFDANNTPAWVDVVTEEKANYFMSSGLKAVRD
LVMGKVILEPEIAKSEDYYNASLSMLAYLAYLDNH

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	27	330	2.7e-76	0.990625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	1.07e-85	26	330	5	318	Glycosyl hydrolases family 8.
PRK11097	PRK11097	2.74e-50	10	253	9	253	cellulase.
COG3405	BcsZ	6.19e-47	15	330	15	343	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYN28333.1	2.07e-115	15	330	12	329
VDZ75051.1	5.90e-115	8	330	6	329
QPS92420.1	5.90e-115	8	330	6	329
BCG07433.1	1.93e-113	15	330	12	329
QFH68625.1	2.74e-113	8	330	6	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5GY3_A	3.44e-100	27	333	2	308	ChainA, Glucanase [Klebsiella pneumoniae]
5CZL_A	6.05e-100	27	330	30	333	ChainA, Glucanase [Raoultella ornithinolytica]
1WZZ_A	7.92e-69	26	330	20	327	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]
6VC5_A	4.30e-68	22	330	1	312	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
4Q2B_A	7.52e-31	28	250	6	230	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27032	9.61e-100	21	330	19	329	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
P18336	7.36e-90	27	305	25	303	Endoglucanase OS=Cellulomonas uda OX=1714 PE=1 SV=1
P37696	9.74e-69	26	330	28	335	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P58935	2.05e-32	29	258	36	268	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1
Q8X5L9	5.80e-32	15	283	14	289	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000400	0.998635	0.000271	0.000236	0.000232	0.000220

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003621_00923.