CAZyme Information: MGYG000003622_00471

Basic Information

• Species: Prevotella sp900770845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770845
• CAZyme ID: MGYG000003622_00471
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		42646.14	8.334

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003622	2890083	MAG	Fiji	Oceania

• Gene Location: Start: 2315; End: 3454 Strand: -

Full Sequence      

MLGMLSCSERRQAETTPWGTTLQQGEGEATHRGKSLPLDDIVANGELIMATLSGPETYYD
YHNYGMGLQYLLCEKFAQSLGVSLRVDVCRDTAEMIRKVERGEADVVAFQLPRSFRGLKF
CGASVDSSNTQWAVGKDNASLAKALNDWFRPEMVAQTRKEENFLLSAGSVERHVYTPMLN
RGAGIISKFDAYFQQYAQTARMDWRLLAAQCYQESCFDPQARSWAGARGLMQIMPATAAH
LGLPEESVYNPQENIAAGARFLSQLQSLFSDIPQSQRANFVLASYNGGSRHIRDAMSLTK
KYGGNPYNWYEVSQYVLKLTDPKYYQDPVAPHGYMRGYETVEYVRHIQSRYAQYCGFAAP
GSFASSGMPQRARKHHRFK

Enzyme Prediction     

No EC number prediction in MGYG000003622_00471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	193	353	9.6e-28	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13403	MLTF-like	9.83e-76	193	355	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
PRK10859	PRK10859	4.96e-54	37	351	35	446	membrane-bound lytic murein transglycosylase MltF.
COG4623	MltF	2.95e-46	38	351	16	427	Membrane-bound lytic murein transglycosylase MltF [Cell wall/membrane/envelope biogenesis, Signal transduction mechanisms].
cd13401	Slt70-like	6.26e-25	189	293	6	112	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	3.89e-24	193	307	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48082.1	2.48e-147	4	378	15	389
VEH15587.1	7.32e-147	4	379	45	432
AGB28026.1	2.13e-146	4	379	38	410
EFC70077.2	2.41e-145	6	378	17	389
QUB48180.1	6.86e-145	6	378	18	390

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA4_B	3.27e-21	91	351	145	411	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013],5AA4_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with cell-wall tetrapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA1_A	4.17e-21	91	351	193	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_B Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013],5AA1_D Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa BWHPSA013]
5AA2_A	4.17e-21	91	351	193	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013],5AA2_C Crystal structure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_B	4.17e-21	91	351	193	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]
5AA2_D	4.17e-21	91	351	193	459	Crystalstructure of MltF from Pseudomonas aeruginosa in complex with NAM-pentapeptide. [Pseudomonas aeruginosa BWHPSA013]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JKM2	1.27e-26	33	357	31	453	Membrane-bound lytic murein transglycosylase F OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=mltF PE=3 SV=1
Q47XX8	1.94e-26	35	351	26	439	Membrane-bound lytic murein transglycosylase F OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) OX=167879 GN=mltF PE=3 SV=2
A6TCH2	3.85e-26	68	357	164	454	Membrane-bound lytic murein transglycosylase F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=mltF PE=3 SV=2
A8GI11	1.51e-25	94	357	186	453	Membrane-bound lytic murein transglycosylase F OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltF PE=3 SV=2
A8AD27	2.49e-25	82	357	175	454	Membrane-bound lytic murein transglycosylase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999747	0.000314	0.000003	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003622_00471.