CAZyme Information: MGYG000003622_01779

Basic Information

• Species: Prevotella sp900770845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770845
• CAZyme ID: MGYG000003622_01779
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
777	MGYG000003622_200|CGC1	84732.23	7.2664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003622	2890083	MAG	Fiji	Oceania

• Gene Location: Start: 5961; End: 8294 Strand: -

Full Sequence      

MKRLIFFVASLLYIGSTSMAQGVAHRGKEPSVDQQVARLLSQMTLEEKVGQLRCTMAWNY
CERKGDDVVLTPLFDKEVLQEGVGNLWATFRADPWTRRSLENGLGPRLSARAANKMQRAV
REKTRWGIPLLMAEEAPHGHMAIGSTVFPTGLGMAATWDAPLMRRVGDAIRRQVRCYGAQ
ISYGPVMDLSRDPRWSRVEESFGEDPVLTATMASAEVAGLSQSHSATDRGVVATLKHFIG
YGTTWGGQNGGPSAITGRDLMQNFLPAFKQALDSGAMSVMTSYNTLDGVPSTGSRELLTE
ILRNQWKFRGIVVSDLYSIDVMYNQHHVAASLEDAAIMALKAGVDIDLGGQAYATLPHAV
RSGRIPESLVDSAVARVLRCKFEQRLFSDPYVDERRAEKETNTPDDKALALQVARESITL
LENRNNTLPLGKDIRVAVVGPNADNVYNMLGDYTAPQPEGNVKTVLDGIRAKLPAGHVVY
AKGCGVRDTTRDDIAEAVEAARGSDVVVACVGGSSARDFKTSYKQTGAAETDANTISDMD
SGEGFDRASLSLLGLQNKLLEALKATGKPLVVVYIEGRPLDKNWAATHADALLTAYYPGQ
EGGTAIADVLFGDWNPSGRLPISVPRSVGLLPVYYNHLPPVPHDYVETTARPLYAFGYGK
SYTTFGYSNLSVNAVDKDSVVVAFDVTNTGRRDGCEVVQLYLNDSVASVAQPVMQLRRFA
RVPLSIGQTQRVSFTLRASDLGLINREKQWVVEPGWFNVMVGAASDDIRLRGRFKIS

Enzyme Prediction     

No EC number prediction in MGYG000003622_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	348	1.4e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	774	1	762	beta-glucosidase BglX.
COG1472	BglX	3.20e-88	43	472	1	386	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	7.27e-78	145	762	111	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	2.33e-74	44	379	1	315	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.74e-68	418	662	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALO48411.1	0.0	1	776	8	786
ADE83756.1	0.0	1	774	1	779
QVJ80985.1	0.0	1	774	1	779
QYR10513.1	0.0	1	776	1	778
QRN02118.1	0.0	23	776	15	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.29e-138	25	769	36	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	9.34e-135	26	776	6	756	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	7.21e-134	26	776	6	756	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5P_A	5.02e-130	15	765	18	754	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5I_A	1.62e-129	36	765	7	722	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	3.98e-137	33	776	35	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	5.59e-137	33	776	35	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.16e-117	125	769	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	5.77e-115	1	769	1	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.97e-93	29	768	32	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000388	0.998910	0.000182	0.000169	0.000167	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003622_01779.