CAZyme Information: MGYG000003622_01864

Basic Information

• Species: Prevotella sp900770845
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900770845
• CAZyme ID: MGYG000003622_01864
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
501	MGYG000003622_212|CGC1	56210.59	9.9588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003622	2890083	MAG	Fiji	Oceania

• Gene Location: Start: 2445; End: 3950 Strand: +

Full Sequence      

MAGEQKSPPQAYQPQRNERMNAKTKFFILAICLITFFANIGALPTDIMESRNIITAREMV
SDGCWLVPTMNGELRLAKPPLPTWVGGLVELVCPGSLAAQRVPAAIMASLWTLFTLLIAR
RLTGRNDFAIVTTVVFLTLYNVVLMGRSATWDIYCHSFMMGAIYFLVKGLKDASGAGVWG
WLLAAGAMMGLSFLGKGPVSFYALLLPFAIAFCLWWRPATMRGKWLPLAACVAVALVVGG
AYYAWLVGYHLPELQQVAHQESGAWVNHNVRPWYYYWRFFLEGGAWAPFILAAMAIPYWK
KRIGQYPEYLFAVGWMLLQLVLLSLMPEKKMRYLLPMAPTVAMSVAFVLLWLIGKSRYGK
ATRIYMWSILGIFVVAELFLLRPIGALFGNPDAHSIALTRQDKRLRGVSFYHNANEDLRI
ELVYEAGKKILPLNLDDSALVAAKLPCAIVSREPIEKEIPANILGGLRVTRIGTFDDNKH
PKSNRHYTQAFVNHVTLIERK

Enzyme Prediction     

No EC number prediction in MGYG000003622_01864.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	22	383	2.2e-57	0.6537037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	1.31e-23	26	392	11	380	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	7.88e-12	78	219	2	134	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.01e-04	27	218	2	203	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
PRK13279	arnT	4.72e-04	56	212	40	193	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMN13732.1	2.93e-22	17	402	3	385
AFT73398.1	2.96e-22	17	402	6	388
AFT77284.1	7.05e-22	17	402	6	388
AMK00316.1	9.34e-22	17	402	3	385
ATR83342.1	1.73e-21	21	461	7	442

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	2.73e-15	26	396	7	381	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A0KGY4	1.89e-13	49	398	30	382	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A4SQX1	3.02e-11	49	398	30	382	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A8FRR0	4.99e-10	29	339	8	323	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
O67270	8.07e-10	25	376	4	347	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.927695	0.068982	0.000777	0.000507	0.000379	0.001659

TMHMM  Annotations     

start	end
26	48
97	119
128	145
149	166
173	195
199	216
225	247
277	299
306	323
333	352
364	386