CAZyme Information: MGYG000003623_00413

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; UBA1191
• CAZyme ID: MGYG000003623_00413
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
325		36641.56	7.6742

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003623	1340166	MAG	Fiji	Oceania

• Gene Location: Start: 39; End: 1016 Strand: +

Full Sequence      

MVCAYNEEDIIAEKMANTHLLDYPADRLHLVWVTDGSTDNTNTLLSAYPEVEIVYSPERR
GKAAALKHGIKEVKTEIVMMTDANTMLNPGAVREIVRLMQDPKVGCVSGEKKVMAKSDSD
EAAQGEGLYWKYESTLKRLDGELYSAMGAAGELCVIRRQLMTDIPDDTLLDDFIISMEIV
RTGYKIAYTSKAYAMEYGSADLHEESKRKRRIAAGGLQSCWRLRSLMNPLRYPVVAFQFV
SHRVLRWTITPVCLFALIPLNTILVLSGEGIIYTVIWVLQILFYASAAAGLRISKYFVFM
NLNVFRGMAYLFNNTSGMWEKAKRA

Enzyme Prediction     

No EC number prediction in MGYG000003623_00413.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	1	214	3.5e-25	0.9652173913043478

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06439	CESA_like_1	3.04e-93	1	219	34	251	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
COG1215	BcsA	1.65e-28	1	321	59	391	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	3.07e-24	4	172	5	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam13641	Glyco_tranf_2_3	1.29e-19	1	211	7	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
pfam00535	Glycos_transf_2	2.12e-17	2	160	4	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN57671.1	2.52e-148	1	325	57	394
QVJ81380.1	9.60e-146	1	325	57	394
ADE82685.1	5.51e-145	1	325	57	394
QUT46616.1	9.35e-132	2	325	57	396
QRQ47436.1	3.78e-131	2	325	57	396

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	2.15e-16	1	185	47	235	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	2.17e-16	1	185	48	236	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6G608	3.02e-15	1	247	52	303	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q8NUI7	3.02e-15	1	247	52	303	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1
Q5HCN1	9.99e-15	1	247	52	303	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	9.99e-15	1	247	52	303	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	9.99e-15	1	247	52	303	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
244	266
271	293