CAZyme Information: MGYG000003624_00002

Basic Information

• Species: Olsenella_B sp900770865
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900770865
• CAZyme ID: MGYG000003624_00002
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1014		110323.53	4.377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003624	2336963	MAG	Fiji	Oceania

• Gene Location: Start: 824; End: 3868 Strand: -

Full Sequence      

MRQTNMTRRLLFGTTGKLAAGATVAGLVATTATGCSSTSDMTRTTPSRPDAEEAKEAAYK
VAARIQDEGTVLLKNSGVLPLAAGSTVMPFGRAYLDPIYGQLTSGGSAKWSVDPVTPETG
LSAFTIDNSAADAMRAAGNPEALEEAEGTAAAGTAGSVLGGDCRIYEYNPSIYDGIAENP
QATGIVFVTRAGQEGQDQKMDAYSDGTPHYLALSQNERGAIKAAKRICGTVVVVIVGSAP
MEVADLISGDLEVDALIHYGHPSERGFTEFSAILDGDVNPSGRTVDTWSADFTADPSYVS
VGLHTYDNLPIKSGSMTDGGEFNRTFNEYQEGVYMGYRYYETAALVDPSFSYDDAVVFPF
GFGLSYTTFSQTLDSVTADDEQVTARVTVTNTGSMAGKDVAQLYLTSPYTELDQAEGIEK
PACVLVDFAKTDELAPGQPQTLELTFDREDMASYCYTHENPSGTVGCYVLETGDYVVSLR
ENSHTVIDQSTVTQDETIWFDGSDEEHIRRSERDAQSPLDDKGNPVEDAGAQYVAASNRF
QASSDYMRKQSRILSRADWSGTKPVYEETKSIDDEFAAGHDLFVTFDPETDERFGNVEGS
LVYAAEEPTSGADNGLVASDLRGRAYDDPMWDALLDQIDWDADKDNIIRNFSGDAYITAR
IDSIDLPETIDMDGGNGLKVQGANTSGYDMAKSCSYGYEPLVASTWNKDLVYQLGVAVGT
EGLAHGISGWYSPGLNLHRSFFSGRVFEYYSEDPVLTGKIAERVVSGTGDMGMYCYLKHF
ILNETDTGRSQLICTWADEQTMRELYLRPFEIALKGARRTMRYTSDDTGAVAEKVTRAGA
AIMASQTCIGTMIGHCNYALLHDVLREEWGFKGMVISDYWVWNGNNHRDLAMRVGCDTYL
CMSIPAMWSISDYDSPTARSCMRTAIHNLAYTVVNSSAMQGMVPGSVQRAEESPWRGLIR
GVDVVAAALVAGGVALIARRSKKELEHPELYKRGKRAQAKLERKLAARRDEDEK

Enzyme Prediction     

No EC number prediction in MGYG000003624_00002.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	661	899	6.9e-41	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.75e-22	702	897	89	275	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PRK15098	PRK15098	2.03e-20	211	490	525	761	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.07e-18	703	900	95	283	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.13e-11	70	337	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam14310	Fn3-like	2.07e-11	399	479	1	67	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAQ32630.1	1.97e-279	53	995	79	1031
QYN59798.1	7.65e-234	52	976	77	1011
QOL34092.1	2.57e-222	52	994	73	1039
QTL79308.1	1.95e-215	50	992	73	1059
ADK68812.1	2.32e-181	53	969	75	951

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	5.72e-45	68	880	46	749	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	3.23e-31	652	880	37	244	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.74e-30	652	897	37	258	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
5WAB_A	2.18e-24	653	895	24	246	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
7MS2_A	2.65e-23	654	912	25	258	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	3.66e-50	62	880	13	698	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.72e-47	68	896	38	790	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P27034	1.76e-29	630	908	1	245	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	3.59e-24	666	908	43	255	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
E7CY69	2.10e-23	653	895	24	246	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as TATLIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000040	0.000104	0.074778	0.000278	0.924804	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003624_00002.