CAZyme Information: MGYG000003624_00047

Basic Information

• Species: Olsenella_B sp900770865
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Olsenella_B; Olsenella_B sp900770865
• CAZyme ID: MGYG000003624_00047
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		39403.73	6.3949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003624	2336963	MAG	Fiji	Oceania

• Gene Location: Start: 9130; End: 10188 Strand: -

Full Sequence      

MAENALHGVNLTGWLTLEPWVTPELFSGSGALDEPSLITSLGAKGYREVVRRHRARFLTK
DDFSRIASRGFNAVRLPVPWYVFGESGPNPGPYLGCIDEVDQALEWAEEIDLKVVFALAV
NPGVPGDEETWNNFTDDRGIRENALWVLSQLSSRYASRMGFYGIEVADDARIQTRRGLGV
TDGMPGHLLRNYYRAAYDRVREAAGPDPVVIIPDAGMPTDWRRFMAQRRYQNVWLDCHLD
KPSAIMADMGYAPGASTLGVRHIMAAIHRHIREDQRSGLPVMVGKWSSALPIADAAMTPE
GRVALERIYSSEQLTAYEKLPAWFFQTWKTTGRLSSWDARVALSSFERGLIC

Enzyme Prediction     

No EC number prediction in MGYG000003624_00047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	331	1.9e-42	0.9668874172185431

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	2.51e-14	6	226	18	239	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	4.12e-06	57	216	24	169	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOY61077.1	1.36e-160	1	351	1	346
ADK68544.1	7.92e-148	1	351	1	346
SDR87855.1	2.85e-143	1	351	1	346
AKT48931.1	2.82e-138	1	351	1	345
ACV51516.1	8.21e-133	1	351	1	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	4.45e-38	6	329	3	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	8.62e-38	6	329	3	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
3N9K_A	2.82e-19	3	330	11	366	F229A/E292SDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]
3O6A_A	3.82e-19	3	330	11	366	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1H4P_A	7.47e-19	6	340	13	382	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XN12	1.87e-32	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
Q4WK60	1.81e-31	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
A2RAR6	4.79e-31	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q5B5X8	2.06e-30	6	345	29	387	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
A1D4Q5	4.59e-30	6	345	42	399	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003624_00047.