CAZyme Information: MGYG000003625_00017

Basic Information

• Species: UBA2913 sp900770895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; UBA2913; UBA2913 sp900770895
• CAZyme ID: MGYG000003625_00017
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		50591.67	5.7544

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003625	2467170	MAG	Fiji	Oceania

• Gene Location: Start: 17380; End: 18675 Strand: -

Full Sequence      

MGIARGDEILLLNSDTIVTPHYLDNMLRALYADERNGAVSCATNHISNNQQVDTDGYTDL
DGLERFAAAYNHSDPTKWQYRTMLVGFCFLVRYSTYKEIGEFDEAFSPGNYEDSDYSMRL
LQAGYHLIFASDTFIHHFGSASFVQRRKKEAELERIRYNELLERNRRKFYAKWDVPWYFR
RMSEEDFRAMQVAKHPDGRWQLDDTKICFITCVSDVVQYDEALSYWQQLRVPEGMTVESL
AIGEAESMTAGYQQAMECSDAKYKIYLHQDVWITDREFLVRLVREFRRHPEYGLAGVVGA
RNMPANGIWWEGEKIGSIRDKITGEFRNYVYRCDRKSSQNAAALDGLLLATQYDMPWRTD
LFRGWHFYDVSQAYEFRRQHFQTVVLPQTRPLCMHNSVEPSVEGYEADRQKFLQEYGSDI
AEEISKDHHRR

Enzyme Prediction     

No EC number prediction in MGYG000003625_00017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	208	416	3.8e-71	0.9952380952380953

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13712	Glyco_tranf_2_5	5.09e-75	208	416	1	210	Glycosyltransferase like family. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
COG1216	GT2	2.47e-18	7	183	86	258	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	1.53e-11	4	139	73	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam13632	Glyco_trans_2_3	4.04e-09	9	149	2	137	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
pfam13641	Glyco_tranf_2_3	5.46e-07	4	148	86	222	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOT69328.1	8.84e-104	3	416	76	498
AEB99503.1	5.71e-65	1	416	76	495
QZY56323.1	9.82e-59	202	420	2	222
AJD33048.1	1.01e-56	202	420	1	221
ANB61420.1	1.24e-56	202	420	1	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003625_00017.