CAZyme Information: MGYG000003625_00779

Basic Information

• Species: UBA2913 sp900770895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; UBA2913; UBA2913 sp900770895
• CAZyme ID: MGYG000003625_00779
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		43110.15	7.0232

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003625	2467170	MAG	Fiji	Oceania

• Gene Location: Start: 2364; End: 3539 Strand: +

Full Sequence      

MKIMLSAGEVSGDLHGASLARAILTQEPATELVGFGGQNMAAAGVRLAADMASYNVMGIS
EVLKNLRRIYRLLDQLTEFMRQERPDLLVLIDYPDFNWRLAKRAKALGVPVFSYIPPSAW
AWRKGRARKCARLADEFVAIFPHELPVYEAAGANISFVGNPLVDTVQPEMPLEEARAHFG
LREQEHAVLLLPGSRRQEIELLLPAMLEAVHILLHGRSGELPTRFFLPVAENVDEELIKR
LISRTGLDGRITLTHEARYALMGIADAAMATSGTVVMEAALMGLPCVVLYRLSKLSYIVG
RLLVHVENFSLPNILLGEQFQPELLQDEVKPARIAHEIEQLYRGEAHREEVVAKLRQACD
RLGPPGAAGRVAAKILAAARRLSPASEAAEK

Enzyme Prediction     

No EC number prediction in MGYG000003625_00779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	358	8e-116	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.46e-127	1	381	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.51e-111	1	381	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.69e-87	3	335	1	332	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.36e-77	3	377	8	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.49e-45	1	329	2	304	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL84303.1	5.45e-176	1	383	1	378
AME03197.1	2.22e-163	1	381	1	376
AKT54064.1	9.01e-163	1	381	1	376
QNH55245.1	9.15e-160	1	380	1	375
ANR70602.1	7.46e-159	1	380	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.72e-49	1	335	7	338	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	6.60e-49	1	335	7	338	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	3.83e-97	3	376	6	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	2.32e-90	2	376	8	377	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	1.85e-89	2	376	8	377	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
B3E4H8	6.40e-84	2	376	8	377	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q1D393	1.01e-82	2	376	6	375	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003625_00779.