CAZyme Information: MGYG000003625_01345

Basic Information

• Species: UBA2913 sp900770895
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Selenomonadales; Selenomonadaceae; UBA2913; UBA2913 sp900770895
• CAZyme ID: MGYG000003625_01345
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000003625_184|CGC1	42594.36	4.971

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003625	2467170	MAG	Fiji	Oceania

• Gene Location: Start: 12492; End: 13655 Strand: -

Full Sequence      

MNKSRFAVLGLALLVLVLAAGVIYGSGWIMNATTNGPAESDDSELTLDQRIDEMIEGMST
TEKVGQLVMIGVHGTEMDEDIRTQLRQFHFGGVILFDRNIKSTEQVQAFVQSLQDTAQGE
GREPAPLFIGIDEEGGQVVRARSVIAPPPSQHEVGLVGKPESARRWATRTSAQLKRLGIN
VNFAPVADIGSGKGRSYSDDPQVVADFVAAAADGYTQRGMIYALKHFPGIGRGQVDSHDE
LSSIKASRSELEQSDLVPFRQLIGQESAENYFILVSHYIYPALDKTQPASQSHAIMTDLL
RQELGYEGVIITDDMEMGALAKHKPFRQMGVDAILAGADMVMMCHEYQHQQDVYMGILEA
VKSGKISEERLDESVRRVLKMKLTHFE

Enzyme Prediction     

No EC number prediction in MGYG000003625_01345.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	343	1.5e-48	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	6.77e-76	58	382	1	312	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.45e-73	59	379	1	314	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.49e-49	68	346	4	282	beta-hexosaminidase; Provisional
PRK15098	PRK15098	1.74e-16	45	382	29	353	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAL82037.1	4.40e-145	45	385	55	394
SNV01291.1	2.84e-142	45	385	47	383
BDA09432.1	3.41e-138	45	385	46	382
CBL06667.1	7.88e-137	1	385	1	382
ANR70188.1	1.80e-129	3	385	6	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	9.70e-65	56	382	9	337	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	3.10e-51	62	382	11	337	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3TEV_A	7.24e-44	65	377	19	330	Thecrystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1],3TEV_B The crystal structure of glycosyl hydrolase from Deinococcus radiodurans R1 [Deinococcus radiodurans R1]
3BMX_A	8.21e-44	39	383	25	394	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
4GYJ_A	4.28e-43	39	383	29	398	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48823	4.55e-48	75	382	49	380	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
P40406	4.50e-43	39	383	25	394	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
Q82SJ8	2.05e-41	68	346	6	285	Beta-hexosaminidase OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=nagZ PE=3 SV=1
Q0A911	2.86e-41	68	345	6	284	Beta-hexosaminidase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=nagZ PE=3 SV=1
Q0AF74	7.80e-41	68	381	6	323	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.911328	0.082571	0.003001	0.000397	0.000265	0.002457

TMHMM  Annotations     

start	end
7	29