CAZyme Information: MGYG000003626_00450

Basic Information

• Species: RC9 sp900771005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900771005
• CAZyme ID: MGYG000003626_00450
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000003626_60|CGC1	41731.28	9.0211

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003626	2792540	MAG	Fiji	Oceania

• Gene Location: Start: 46909; End: 48012 Strand: +

Full Sequence      

MKYYIIAGEASGDLHGGNLIKGLRAEDPQAQIRVWGGEMMQEAGAELVHHYKEGAVMGVT
DVLGKGFKLLKNLSVCKKDISDWCPDVVILIDYPGFNFKIAEYAHKKGFKVFYYIAPKTW
ASRESRNRKLKKYIDRLFIIFPFEKAYFDKHDIPYVYKGNPLIDAIDRHEYVRPVEGKYI
ALLAGSRKGEISRMMPVCMQVADRFPGYRFVIAGAPSRTEKDYRKFIGNRDNVELLFSRT
YDILKYAEAAVINSGTASLEAALIGTPQVVCWSSSAITIFVAKNILKVMDHIRFISLGNL
IMNKFVFQELIQDSFNPDNVTEELRNLLEDSDYRSEMKLDYKQIRNELGGQGASSAVAKA
MIEELRK

Enzyme Prediction     

No EC number prediction in MGYG000003626_00450.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	348	6.4e-107	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.72e-112	1	367	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.11e-109	1	367	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	2.69e-80	4	360	2	370	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.84e-68	5	363	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.71e-56	1	365	2	347	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX05067.1	8.74e-115	1	366	1	370
AGY53532.1	1.12e-112	1	366	1	371
AXT63671.1	8.96e-112	1	365	1	369
BAX81022.1	4.24e-111	1	367	1	375
EAP88054.1	1.02e-110	1	365	1	369

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.02e-38	5	363	11	379	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.02e-38	5	363	11	379	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q39T49	3.41e-67	2	367	8	382	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B3E4H8	1.24e-63	2	358	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.51e-63	2	367	8	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q2LVL8	1.91e-62	5	367	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q1D393	1.05e-57	2	365	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003626_00450.