CAZyme Information: MGYG000003626_01381

Basic Information

• Species: RC9 sp900771005
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9; RC9 sp900771005
• CAZyme ID: MGYG000003626_01381
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	MGYG000003626_197|CGC1	97409.99	4.945

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003626	2792540	MAG	Fiji	Oceania

• Gene Location: Start: 19216; End: 21798 Strand: -

Full Sequence      

MKRLFIALAGLFTIMSAAAKDNAGIMSSTSGQDCFTLIENSKPLGILVSDADRKGILIAA
GNLQSDFERVCGHKASLYSEITDKRCIIAGSLDSPYIKSIVKSGLIDEAELKGKVEKYIM
TVIENPLEGIDEALVIAGSDMRGTIYGIYELSEQIGVSPWYDWMDVPVPHNDNLSIKKGT
YTAGEPAVRYRGIFLNDEAPCLTSWVKNTYGTDYGDHRFYARVFELILRLRGNFMWPAMW
GWAFYADDPLNSQTANEMGVIMGTSHHEPMARNHQEWVRYNGSKGEWDYTVNSKVLDEFF
REGMHRALETEDLITIGMRGDGDTAMGAKEGHDDEFVSNDAAIIKLLEKIVRNQRRIISR
ETGRPASERQQVWALYKEVQRYYDQGMKVPEDAIILLSDDNWGDIRRLPTAADRQHKGGF
GMYYHVDYVGAPRNSKWLNITPIQHIWDQLTLTYQYGVDRLWVLNVGDLKPMEYPISLFM
DIAWNPSRYNAGNLLDHPRKFCAQQFGEDQADEAARILNLYSQYSGRVTAEMLDKNTYDL
ESGEWKQVSDEFTKLEAEALRQFISLPDEYRDAYRQLILFPVQALSNVYEMYYCQAMNNK
LYLEGNPEANVWADRTEAAFKRDADLCAAYNREMSGGKWDGMMTQKHIGYFSWNDNFPAD
RLPRINRFENAGQMKGNFISKASDGFIGIDAEHYFSCTGSAEAQWTVIPFMGRTRSGISL
QPYNASVEGASISYRMEIPEGIDSVDVHVITASTLAFARQDGHRYAVGFEGQEPVVVNFN
GELNEEPENVYRIMYPTVASRVIEKTVRMKVPGSGERNLTISPLDPGVVLEKIIVDLGGY
HKSFLFGKESPLTRGQIFEQ

Enzyme Prediction     

EC	3.2.1.131

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	33	833	5e-265	0.9971305595408895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	184	532	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	1.07e-37	683	849	5	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.001	56	151	33	120	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADD61499.1	0.0	15	854	17	858
EEC54467.1	0.0	15	854	17	858
QRQ48278.1	0.0	15	854	17	858
QUT46101.1	0.0	15	854	17	858
ABR37760.1	0.0	15	857	17	861

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C90_A	0.0	1	854	12	853	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PUG_A	0.0	19	857	1	841	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PXQ_A	0.0	21	854	2	837	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
4ZMH_A	2.36e-171	46	665	25	630	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
6NPS_A	1.50e-113	55	656	31	648	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000321	0.998979	0.000214	0.000163	0.000154	0.000141

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003626_01381.