CAZyme Information: MGYG000003627_01235

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1732
• CAZyme ID: MGYG000003627_01235
• CAZy Family: GH51
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		35369.25	6.2985

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003627	1872155	MAG	Fiji	Oceania

• Gene Location: Start: 1096; End: 2046 Strand: -

Full Sequence      

MQEVLDLVEWANGPVTSKWGKVRADAGHPEPFNLKYIGIGNEDLISDVFTERYSMICKAI
KAKYPHINVIGTVGPFSEGPDYMDGWSLAKQLKLDLVDEHYYRSPGWFIHHQHFYDNYDR
NGTKVYLGEYAAHVGNRSNCIESALAESIYLTSVERNGDVVSMTSYAPLLCKDGHGNWNP
DLIYFSNNDIRPTVGYYAQQLFSLNAGDKYVETLLNLDSDDSNALVRVGASTVFDTKNSA
AILKIVNILPVNVNIELSLKNLRGLPCSADMFVLAGKPSETKVKPIASKIQMEETCKVKL
QPYSLTVIRMPNVSFR

Enzyme Prediction     

No EC number prediction in MGYG000003627_01235.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	2	310	7.6e-59	0.5238095238095238

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06964	Alpha-L-AF_C	2.71e-27	128	304	1	192	Alpha-L-arabinofuranosidase C-terminal domain. This family represents the C-terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase (EC:3.2.1.55). This catalyzes the hydrolysis of nonreducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
smart00813	Alpha-L-AF_C	5.47e-23	128	304	1	189	Alpha-L-arabinofuranosidase C-terminus. This entry represents the C terminus (approximately 200 residues) of bacterial and eukaryotic alpha-L-arabinofuranosidase. This catalyses the hydrolysis of non-reducing terminal alpha-L-arabinofuranosidic linkages in L-arabinose-containing polysaccharides.
COG3534	AbfA	3.08e-09	2	42	133	173	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK86781.1	1.74e-123	1	310	441	751
QEW35198.1	4.19e-123	1	310	435	745
QIU94064.1	5.97e-123	1	310	506	816
QQY42766.1	3.22e-122	1	310	517	827
QUT56491.1	3.22e-122	1	310	517	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZPS_AAA	3.89e-35	1	215	309	528	ChainAAA, MgGH51 [Meripilus giganteus],6ZPV_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPW_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPX_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPY_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZPZ_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ0_AAA Chain AAA, MgGH51 [Meripilus giganteus],6ZQ1_AAA Chain AAA, MgGH51 [Meripilus giganteus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P82593	1.17e-62	1	232	339	567	Extracellular exo-alpha-L-arabinofuranosidase OS=Streptomyces chartreusis OX=1969 PE=1 SV=1
Q8VZR2	4.62e-36	1	262	346	594	Alpha-L-arabinofuranosidase 2 OS=Arabidopsis thaliana OX=3702 GN=ASD2 PE=2 SV=1
Q9SG80	1.75e-33	1	219	347	556	Alpha-L-arabinofuranosidase 1 OS=Arabidopsis thaliana OX=3702 GN=ASD1 PE=1 SV=1
Q2U790	9.78e-31	1	235	327	553	Probable alpha-L-arabinofuranosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=abfA PE=3 SV=2
B8NKA3	1.33e-30	1	235	327	553	Probable alpha-L-arabinofuranosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=abfA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003627_01235.