CAZyme Information: MGYG000003627_01517

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1732
• CAZyme ID: MGYG000003627_01517
• CAZy Family: GH10
• CAZyme Description: Endo-1,4-beta-xylanase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		42242.09	7.9363

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003627	1872155	MAG	Fiji	Oceania

• Gene Location: Start: 728; End: 1840 Strand: +

Full Sequence      

MQSTNSFGRTLLLSTLAFVASFCSVQGQEPAKTLRDASKGFFEVGVALPDRVVRDERLNK
IAALQFNRVVCENEMKFESLEPQENRFTFERGDRLVEFAQKNGMSVHGHTLVWHAQTPRW
VFQDANGGQASKELVMKRLKNHIDTVMKHYKGKIKTWDVVNEAFTDQGNLRTSSPWYRAL
GNDLIKIAFTLAREADPDAILIYNDYSMPNDPKRQGIIKAIKEINKEKKIIDGIGYQGHW
DLNWPSLAQIQKAIDEAREAGLKLYISELDINTDRSKRNSGRGLEANPEIDPSTLQPITD
MNVVLRDRYREIFEIFLKNADVIEAVTVWGLDDAHSWIRGEPLLYDRNQNPKPALQAIID
LMNKTPKTQK

Enzyme Prediction     

EC	3.2.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	36	360	1.1e-104	0.9834983498349835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00331	Glyco_hydro_10	2.78e-116	34	360	1	310	Glycosyl hydrolase family 10.
smart00633	Glyco_10	6.47e-113	75	358	1	263	Glycosyl hydrolase family 10.
COG3693	XynA	1.91e-98	12	366	5	345	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].
cd17542	REC_CheY	0.008	188	266	37	100	phosphoacceptor receiver (REC) domain of chemotaxis protein CheY. The chemotaxis response regulator CheY contains a stand-alone REC domain. Chemotaxis is a behavior known for motile bacteria that directs their movement in response to chemical gradients. CheY is involved in transmitting sensory signals from chemoreceptors to the flagellar motors. Phosphorylated CheY interacts with the flagella switch components FliM and FliY, which causes counterclockwise rotation of the flagella, resulting in smooth swimming. REC domains function as phosphorylation-mediated switches within response regulators, but some also transfer phosphoryl groups in multistep phosphorelays.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFN75725.1	8.82e-98	11	363	3	369
ACW02028.1	4.57e-91	42	359	6	338
ACP87400.1	4.57e-91	42	359	6	338
ACW01955.1	4.51e-90	10	361	7	372
ACP87327.1	4.51e-90	10	361	7	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FHE_A	7.09e-81	28	359	7	339	Highlyactive enzymes by automated modular backbone assembly and sequence design [synthetic construct]
2Q8X_A	3.13e-80	33	361	7	331	Thehigh-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],2Q8X_B The high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from G. stearothermophilus [unidentified],3MSD_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSD_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MSG_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
1N82_A	1.76e-79	33	361	7	331	Thehigh-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],1N82_B The high-resolution crystal structure of IXT6, a thermophilic, intracellular xylanase from G. stearothermophilus [Geobacillus stearothermophilus],3MUA_A Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUA_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MS8_A	2.49e-79	33	361	7	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MS8_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]
3MUI_A	1.40e-78	33	361	7	331	Enzyme-Substrateinteractions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus],3MUI_B Enzyme-Substrate interactions of IXT6, the intracellular xylanase of G. stearothermophilus. [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48789	1.91e-79	1	361	1	367	Endo-1,4-beta-xylanase A OS=Prevotella ruminicola OX=839 GN=xynA PE=3 SV=1
O69231	1.58e-77	42	359	16	329	Endo-1,4-beta-xylanase B OS=Paenibacillus barcinonensis OX=198119 GN=xynB PE=1 SV=1
P49942	1.03e-74	11	365	8	375	Endo-1,4-beta-xylanase A OS=Bacteroides ovatus OX=28116 GN=xylI PE=2 SV=1
P45703	1.87e-72	33	361	7	330	Endo-1,4-beta-xylanase OS=Geobacillus stearothermophilus OX=1422 GN=xynA PE=1 SV=1
P23556	3.77e-72	31	359	18	340	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000813	0.701028	0.297421	0.000282	0.000239	0.000197

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003627_01517.