CAZyme Information: MGYG000003627_01523

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1732
• CAZyme ID: MGYG000003627_01523
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799		91220.53	7.153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003627	1872155	MAG	Fiji	Oceania

• Gene Location: Start: 2240; End: 4639 Strand: +

Full Sequence      

MRKNILLFSATSVFCAMSSFPLSAQSIKTVVDKKAEPFPLSAVKLLDSPFLERQKEDTEY
LVNFLNPDRLLAAIRERAGLPKKAERYGGWEAQGINGHGLGHYMSALAACYSVTGNVKAK
EKLEYILNELEECQNRNGDGYVMSVDKKVYERVKSGNFTIGGFDINGWWVPNYTLHKIFA
GLRDAYRYAGLPKALEIERKLGDWYLSIVSPLNDEQIQKLLGSEWGGMNETFCQLGEDTG
DKKYLDAAEKYFNHKRIFDPLKRGEDRLTGLHANTQVPKIAGLALLYELTGNQEYHTAVE
TFWNSVVNERSFANGGHSDSEHFFDVRQFPTKLGPKNSETCNVNNMIRLTGHTFQWNPTA
NQMDFIERALYNQILANIGHKGGEFGYFISQKPVAMKVFSTKENAWWCCVGTGMENPMHY
GEHIYYHKGNQLWINLYIASKLDWKEQSVVLEQTTDMLNTDISEFIIHTTNASNNLALKF
RIPYWCKNPILKINDKQQSIQAKPSSYVEISRIWKDGDKISLTMPKEFHIDPLPYSNNKY
VAIMYGPLVMTGVVPPEKGKDDLAKRRWDDHLRASGGTNESATLLVTDDPQSIVKSLKMV
ENNGSKGMLAVSENLGKPQEVKLMPFYQIYEEHYTMYFPVIGTDSWKKEQERIEAAAAEE
RRLEALRTDVLMPGFQQDEVNHDFHGNNSESGDFRDRKYRHARGAEGWYSYKMRVSGNSP
MKLVVTYYSEDRGREFEIYVDDTKLITEKLNVAQRNLFYDKVYEIPQALTQGKETVTIKF
QGTPSTSYVGGIFKLVMTK

Enzyme Prediction     

No EC number prediction in MGYG000003627_01523.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	43	550	2.1e-182	0.9940357852882704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.52e-157	42	549	1	501	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.51e-108	33	562	4	508	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam03663	Glyco_hydro_76	8.07e-05	233	356	164	287	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
cd04434	LanC_like	3.41e-04	98	296	2	240	Cyclases involved in the biosynthesis of lantibiotics, and similar proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain thioether cross-links called lanthionines (Lans) or methyllanthionines (MeLans), in addition to 2,3-didehydroalanine (Dha) and (Z)-2,3-didehydrobutyrine (Dhb). These unusual amino acids are introduced by the dehydration of serine and threonine residues, followed by thioether formation via addition of cysteine thiols, catalysed by LanB and LanC or LanM. LanC, the cyclase component, is a zinc metalloprotein, whose bound metal has been proposed to activate the thiol substrate for nucleophilic addition. A related domain is also present in LanM and other pro- and eukaryotic proteins with poorly characterized functions.
pfam16375	DUF4986	0.002	589	638	35	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX60435.1	2.29e-180	2	793	3	783
AET59347.1	2.99e-176	26	784	2	743
QNR70044.1	4.66e-176	34	784	2	735
APB78465.1	6.58e-176	34	784	2	735
ALA44767.1	9.28e-176	34	784	2	735

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	1.85e-153	28	789	18	795	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	9.55e-150	28	789	18	795	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
5MQO_A	3.30e-16	239	549	255	605	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007424	0.605114	0.380854	0.004597	0.001183	0.000798

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003627_01523.