CAZyme Information: MGYG000003627_01526

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1732
• CAZyme ID: MGYG000003627_01526
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
374		43357.71	6.7699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003627	1872155	MAG	Fiji	Oceania

• Gene Location: Start: 349; End: 1473 Strand: +

Full Sequence      

MILVFKKKRASIKKSNVLSFITVVLSLIFLFLNNSCRIMNQKDLSPKATFSFVKNMGMGW
NLGNTFDNLVLKEHDYETGWGNPKVTPELIHFLKKQGFKTIRIPVSWGVRCGPAPSYQIP
EKMISRLKEVIQWCMHEDMYVILNMHHESEWIHAATDDYGTFFQKYSAIWKQIAQNFGEF
DERLIFESMNEIGFPKLDVDSAADLLNKVNAEFVKIIRDSKFEQNKYRFLLLAGLDTDVD
KSLGRIHFPDDSYRCILSIHYYTPSVFTIAEPGTSWGYRSDWGNQEDLEQLKRQFAKLKT
GFMNNGMPVILGEFGCLVHSKDSVSRHNYFEAIIKEAVSYGICPIFWDNGEELDRNNLTW
RHPDVDEAFVSIHD

Enzyme Prediction     

EC	3.2.1.151	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	76	350	1.3e-83	0.9927536231884058

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	1.84e-55	76	350	15	269	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.33e-24	6	350	2	360	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGS51528.1	9.46e-82	43	372	37	374
CBL17363.1	1.63e-77	40	365	30	366
QQA02033.1	2.86e-75	52	357	48	359
QOS40598.1	3.28e-74	56	355	46	353
AEY66181.1	2.07e-72	7	370	2	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PZ7_A	4.55e-63	40	371	3	335	GH5-4broad specificity endoglucanase from Clostridium acetobutylicum [Clostridium acetobutylicum ATCC 824]
4IM4_A	1.02e-61	41	370	2	332	ChainA, Endoglucanase E [Acetivibrio thermocellus],4IM4_B Chain B, Endoglucanase E [Acetivibrio thermocellus],4IM4_C Chain C, Endoglucanase E [Acetivibrio thermocellus],4IM4_D Chain D, Endoglucanase E [Acetivibrio thermocellus],4IM4_E Chain E, Endoglucanase E [Acetivibrio thermocellus],4IM4_F Chain F, Endoglucanase E [Acetivibrio thermocellus]
2JEP_A	4.47e-58	53	370	39	391	Nativefamily 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEP_B Native family 5 xyloglucanase from Paenibacillus pabuli [Paenibacillus pabuli],2JEQ_A Family 5 xyloglucanase from Paenibacillus pabuli in complex with ligand [Paenibacillus pabuli]
3NDY_A	1.33e-57	53	370	16	338	Thestructure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDY_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans [Clostridium cellulovorans],3NDZ_A The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_B The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_C The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans],3NDZ_D The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose [Clostridium cellulovorans]
4YZP_A	2.72e-56	41	370	16	328	Crystalstructure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis [Bacillus licheniformis],4YZT_A Crystal structure of a tri-modular GH5 (subfamily 4) endo-beta-1, 4-glucanase from Bacillus licheniformis complexed with cellotetraose [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O08342	3.33e-59	43	350	34	369	Endoglucanase A OS=Paenibacillus barcinonensis OX=198119 GN=celA PE=1 SV=1
P10477	3.80e-57	34	370	45	382	Cellulase/esterase CelE OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celE PE=1 SV=2
P28623	2.71e-55	53	370	47	369	Endoglucanase D OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engD PE=1 SV=2
P54937	3.14e-52	8	370	2	375	Endoglucanase A OS=Clostridium longisporum OX=1523 GN=celA PE=1 SV=1
P28621	1.42e-50	53	370	46	371	Endoglucanase B OS=Clostridium cellulovorans (strain ATCC 35296 / DSM 3052 / OCM 3 / 743B) OX=573061 GN=engB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000006	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
17	34