CAZyme Information: MGYG000003631_00604

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000003631_00604
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
573		63798.55	6.3208

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003631	1663259	MAG	Fiji	Oceania

• Gene Location: Start: 11; End: 1732 Strand: +

Full Sequence      

MDKVSPEADLYAQEGASHAAVAQLNALLKDGRKWTVPAHTEVSACWQLGDYYGAYPHLVV
SGGKGAVVRWGWAESLYTKEGEKNVRSQFADKRFIGTFDTFRMDGRPRATFNVQWWRCGC
WCELKIKTADEPLTFEEIAIDETRYPLEPECSFVCDDPSFGPIQRICTRVMQSCCHEMLF
DGPFYEQQMYPGDTRVQLLSLSALSRDDRMIRRAIEVFDFGQRDDGQVPFNAPTQGTQEG
ATYTQCWLLMHGDYATYHDNFDWLKARLPAMRKALSGFELYENGAGLLAALPGWNFMDWD
KNWTAGTAPGAYAGEGPSSLVNLFYVLDLQSAAKAERACGNEMMARAWESKIPALKKAIL
DAFWDESEGMLLDVPAETKDGKTLKTRSEHAQVLGIVSGVLEGDRAKRAFDAMLAVKDDP
KFARCTVYFSHYLFQACFLMNRADCVMKRLDLWRTYVAQGCATTIEHPEWKGHVSRSDCH
AWGSHPLYWMQAGFAGVTPAKPAFAEVRVAPQPAGLKTIRAKVPHPKGFVEENLAFEGGA
ARGTVTLPAGVAGTFEFGGKTLALKPGVNRIGE

Enzyme Prediction     

No EC number prediction in MGYG000003631_00604.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	48	555	3.8e-89	0.9702380952380952

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	7.88e-21	152	490	5	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3459	COG3459	1.43e-05	247	421	673	862	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17390	Bac_rhamnosid_C	8.88e-04	496	554	1	60	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ43235.1	2.25e-116	26	567	257	784
QYM79363.1	7.57e-116	13	571	254	800
QPC84684.1	7.28e-114	27	571	263	794
ABU57036.1	1.36e-107	26	570	241	772
CCW35533.1	1.96e-103	17	571	243	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	3.51e-27	124	528	510	910	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	3.57e-10	157	491	213	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003631_00604.