CAZyme Information: MGYG000003633_00064

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16
• CAZyme ID: MGYG000003633_00064
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
268	MGYG000003633_17|CGC1	29995.84	4.4102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003633	1440722	MAG	Fiji	Oceania

• Gene Location: Start: 4604; End: 5410 Strand: +

Full Sequence      

MYIISILPALALVGCCSSAPKSPTTPYDGVAHPSQVILTSAAVSSGTDTISMGVCVYLPQ
DYSEAQTYPVLYLLHGSGDNETGWVVKGNMQAIMDSLITSGSTVPMVVIMPNGYAEHYNT
WFGTDIPEPEQRHWMDGYFEAFFPSLMDWTAEHYSIYTDKAHTAIAGLSMGGYHTIHVAG
LLQGRFDYVGPFSAVEKVLPQLDTVMMGNPRLFWMAIGEDDFLYGNNEDMRAYMDERGYT
YTYHESQGGHDWPNWMDYLRLFTPQLFH

Enzyme Prediction     

No EC number prediction in MGYG000003633_00064.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	52	262	4.1e-46	0.9295154185022027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	1.44e-19	56	266	86	299	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam00756	Esterase	1.07e-18	51	255	7	235	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	6.96e-13	41	255	24	297	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2819	YbbA	6.82e-07	54	193	25	169	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG1506	DAP2	1.68e-06	56	262	382	609	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE20341.1	9.87e-54	54	267	166	396
QUB42247.1	6.76e-52	45	267	146	386
QQA30430.1	3.34e-51	56	267	166	397
QUT65236.1	3.34e-51	56	267	166	397
QUT61959.1	3.34e-51	56	267	166	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	4.76e-37	56	267	150	385	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	9.49e-29	17	255	10	246	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	2.59e-28	17	255	10	246	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.38e-27	56	267	157	385	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOT_A	2.39e-24	56	267	135	358	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	2.36e-26	17	255	29	265	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	2.08e-24	56	267	449	669	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	2.99e-13	56	267	518	725	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P31471	4.50e-11	56	267	161	388	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P23553	6.68e-10	64	259	37	254	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000172	0.999891	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003633_00064.