CAZyme Information: MGYG000003634_00763

Basic Information

• Species: SFVR01 sp900771035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; SFVR01; SFVR01 sp900771035
• CAZyme ID: MGYG000003634_00763
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000003634_103|CGC1	42559.3	10.0031

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003634	1732908	MAG	Fiji	Oceania

• Gene Location: Start: 269; End: 1396 Strand: -

Full Sequence      

MRYLLIAGEASGDLHASRVMKNLIKFDPEAEFRFFGGDKMSRYGGDPIVHCRDMSFMGFV
NVLRNLGKIRETRRRAEFQLLDFRPHHVILVDYPGFNLRFAKYVKRHLPSAVVHYYIAPK
LWVWKEWRLKSLRRYVDHVYSILPFETEWFGARGYHVDYVGNPSVDAISSFRRRGFDHGL
FRQHNGLDSRPIIALLAGSRMQEISSCLPVMVSCIPQMPDHQFVVAAAPGVETETYRRIL
GSAADSVRIIKNATYELLSLSDGAIVNSGTATLEAALFRVPQVVVYKVFGGRFTMALKPL
FLHTRFVSLVNIIAGHEVVRELLGHRFTADATLRELRHALTDGRSEMLSGYDRIISLLGP
AGAGERVAKRITDCF

Enzyme Prediction     

No EC number prediction in MGYG000003634_00763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	352	4.1e-100	0.9717514124293786

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.85e-92	1	373	2	373	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.21e-87	1	375	2	379	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.24e-69	4	340	2	337	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	5.18e-59	4	353	9	354	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.07e-53	1	371	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50508.1	1.67e-123	1	371	1	371
BBK92630.1	1.75e-115	1	373	1	373
QUR47916.1	1.75e-115	1	373	1	373
ABR44355.1	3.52e-115	1	373	1	373
QRO15504.1	3.52e-115	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.82e-28	5	345	11	350	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	3.36e-27	5	345	11	350	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	5.69e-60	2	373	6	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q74AT9	4.08e-56	2	373	8	378	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q39T49	2.40e-54	2	373	8	378	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
B4UHR6	9.74e-53	4	371	12	378	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
B3E4H8	1.37e-52	2	368	8	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003634_00763.