CAZyme Information: MGYG000003636_01471

Basic Information

• Species: UBA1724 sp900771165
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; UBA1407; UBA1407; UBA1724; UBA1724 sp900771165
• CAZyme ID: MGYG000003636_01471
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		41405.19	9.4058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003636	2261924	MAG	Fiji	Oceania

• Gene Location: Start: 3347; End: 4480 Strand: +

Full Sequence      

MPHLIICSGGTGGHFYPALALAREYSLRGGKVTLLLSGQQVEAQRETVARHGLECREIPS
VRAPRSLGQLLLFPFRFLACVRKIRRLFRELQGDALLSMGSFTAVAPCFCWPRRSRSLFL
HEGNTFMGQTNRLFAKKASLILLTLPLANPRQCKGTPAQIVGMPLRDTLLEAAKTPPSPQ
EREALLQDFGLLPGRKTLLVFGGSQGAQAITRLLLHTLPLLAPLASRIQLICLTGSDDNT
ALEEACQAAGIPAHIRKADHQIQRCYQAADAVLCRAGASSLCELALFRKTAFLIPLPSAK
DNHQYWNARTLADHQAALLLPQKDTTPEKLQEVLQQWLQEPEAFQEFARRIGDFAQPQAT
AKAIDALEKAMAALPQA

Enzyme Prediction     

No EC number prediction in MGYG000003636_01471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	197	359	1.7e-41	0.9936305732484076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	8.82e-87	1	373	1	357	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	6.14e-81	3	365	1	349	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	3.59e-72	4	369	3	353	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	1.59e-63	4	367	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	3.43e-29	197	349	1	152	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM45852.1	4.96e-59	4	359	6	360
QSH42448.1	7.47e-48	1	360	8	363
QDQ42647.1	3.79e-46	3	371	5	364
AVX31455.1	7.43e-46	4	370	3	368
AVX21035.1	7.43e-46	4	370	3	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	1.78e-33	3	366	4	350	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
1F0K_A	3.31e-32	4	340	9	325	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]
7D1I_A	1.34e-26	3	369	11	364	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1WRL1	3.57e-44	5	334	8	323	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Verminephrobacter eiseniae (strain EF01-2) OX=391735 GN=murG PE=3 SV=1
B8J8E8	4.37e-44	4	365	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=murG PE=3 SV=1
B4UES1	1.19e-43	4	365	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=murG PE=3 SV=1
Q2IG27	1.67e-43	4	365	3	351	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=murG PE=3 SV=1
A1AU61	3.19e-41	4	355	3	358	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) OX=338966 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003636_01471.