CAZyme Information: MGYG000003637_00140

Basic Information

• Species: W0P29-029 sp004558035
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA953; W0P29-029; W0P29-029 sp004558035
• CAZyme ID: MGYG000003637_00140
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		96149.76	9.3923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003637	1987494	MAG	Fiji	Oceania

• Gene Location: Start: 697; End: 3321 Strand: -

Full Sequence      

MFKIPSLDSLPLRIAAGALALAFSGTLFAQTTALTEEQTAQLAKLAERYGGPSAAKPAKG
KTRTAAAKPAVSFKLDKKQKGFRVRANGPTVSVTAGTLNELAAGYGYYLKHGKNLMWSWS
ANRLAPAVPAKQKEFSAETPWEWRYAYNYCTLSYTSAFWGKTEWRNELDRMALNGVNRVL
VQAGLEKVWQLTLAELGYPKEKIFAYIPSPAFAAWWNMGNLEGHGGPLTQSQIDGEAALG
KFIVSYMRNYGMEPILQGFVGLVPHDFGEHCRLEGLRIIPQGNWVDGFLRPAVLDPTTPA
FSKVAEVWYRNLEKVYGVKAKAFGGDLFHEGGKSGGIAVADAAKCVQTAMQKASPGSVWV
LQAWHGNPSATLLSGLDKDKCVVLALCKDMVAGTSHGYSYHGAPWVWCELSNFGGNHGLY
GSLKVLGKIGVMATADGSDKLVGIGLIPEGTEVNPITYDLLYDRIWTPRETVMDDAEIAT
WIDGYALRRYGKNVPAVNRAWKLLERSVYSPTQDQEGCTESIISARPNRNAQKASTWASG
KVYWNPDDVRAAFALLVGAGEKDAALAALSTYRWDLCDVGRQFASDLARPLLAKAMEAYD
AGDKKAFELRSKQFLDLIASTDRLLATHTLWRFGRMYQMALAKGKSKAEKENSTRALKTL
LTSWGGKPGSLNDYAHRQLSGLLKDYYLVRWGYFFDAHKKALNGDRSALDALEGKINALM
NDWCKATKPVYTAKAEGKTLVEARNMLKKFAPIADELFSVPVDNDRPWTIRDGAKELVFD
VSDDIMKAGTFTATFRWKSGDSALVVKRVRLYEGDKLVAEDAHRGTTGHDDQNNVYTLEV
KQLRTSLDAYVLKADVEGLSSNNSSGVLIFSRAK

Enzyme Prediction     

No EC number prediction in MGYG000003637_00140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	89	748	2.3e-182	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	3.39e-128	144	468	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	1.82e-65	481	744	1	258	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQL44102.1	1.58e-246	81	872	53	840
QWP06883.1	1.14e-242	64	872	26	834
QWP18308.1	1.14e-242	64	872	26	834
QTF01983.1	1.14e-242	64	872	26	834
QTF04293.1	1.14e-242	64	872	26	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	1.81e-104	100	760	223	879	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	2.14e-104	100	760	231	887	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	2.10e-103	100	760	246	902	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	5.61e-79	83	697	51	658	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	4.77e-80	88	752	92	806	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	4.85e-78	83	697	74	681	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001191	0.997963	0.000289	0.000192	0.000189	0.000176

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003637_00140.