CAZyme Information: MGYG000003637_00277

Basic Information

• Species: W0P29-029 sp004558035
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA953; W0P29-029; W0P29-029 sp004558035
• CAZyme ID: MGYG000003637_00277
• CAZy Family: GH20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
729		79862.76	9.0553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003637	1987494	MAG	Fiji	Oceania

• Gene Location: Start: 86; End: 2275 Strand: +

Full Sequence      

MKFIDVLSLYKINRLHWHLVDSEGWRLEIKKYPKLAKLCDEYPAYYDCEDPTNKAARATF
KYGYFHGGGHYTQEDVKEIVAYAKARHVEIMPEIEFPAHAMAALTAYPEFNTSGKVPSVR
SNHSPDLILPNDKGLGFLKDILNETMDLFPFGFIHFGGDEAPKGHWKESPIAQAKIRELG
LDKHGDKAENALQAWMFNEMAAHVAKRGKRPVGWEEIMHDDNMEHLTKKAVIMPWLSLGN
AVKSANAGHGVIHVSTAPFYLDSQQSDSPADNWPLYDGTAFRLPNLYNFNLFPGSLTAEG
RKNILGAQCQLWAELLPKPEHVEFQAFPRVLALAELTWTPQERKNYDDFYRRLIPQAKLL
DAHKINYRHIDPLPSGTWSADALSSKTFEIPVEPARLKAADETGLVAAFRHTKGAPLKLR
KVELLRGGKVVAADEHDDVADEKTPGGVAFRLPLETPVPAGKYALRVTHANASGERDSAG
EVRVFSGRRGTALFDPRNFRGGDYPSALWNKTQTKGGKADVRFSTEGLLTAPGDYELVFT
AKNPEEEILVSRLRVAGAKNETPVSKAVAKISAQNPTGIVPVKIDAKALRGGNALVATVE
SKKPSQGEIRVRRAEAFPKKGGKFAWNADVLSKGAVLYARDVAVKSAGRLRATFRYTGGG
NGADILSVQALSAGAVVAEDSHKGFAGGNPKDNVFTLESSALKPGAKIDLRVTMAGAGGT
NSEGEITVE

Enzyme Prediction     

No EC number prediction in MGYG000003637_00277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH20	2	341	1.6e-87	0.8991097922848664

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06563	GH20_chitobiase-like	2.02e-144	2	353	22	357	The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This GH20 domain family includes an N-acetylglucosamidase (GlcNAcase A) from Pseudoalteromonas piscicida and an N-acetylhexosaminidase (SpHex) from Streptomyces plicatus. SpHex lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
pfam00728	Glyco_hydro_20	2.22e-110	1	340	21	345	Glycosyl hydrolase family 20, catalytic domain. This domain has a TIM barrel fold.
COG3525	Chb	2.18e-75	4	387	284	664	N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism].
cd06570	GH20_chitobiase-like_1	1.71e-60	4	353	24	311	A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin. Chitin is degraded by a two step process: i) a chitinase hydrolyzes the chitin to oligosaccharides and disaccharides such as di-N-acetyl-D-glucosamine and chitobiose, ii) chitobiase then further degrades these oligomers into monomers. This subgroup lacks the C-terminal PKD (polycystic kidney disease I)-like domain found in the chitobiases. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.
cd06562	GH20_HexA_HexB-like	1.90e-60	1	353	21	337	Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides. The hexA and hexB genes encode the alpha- and beta-subunits of the two major beta-N-acetylhexosaminidase isoenzymes, N-acetyl-beta-D-hexosaminidase A (HexA) and beta-N-acetylhexosaminidase B (HexB). Both the alpha and the beta catalytic subunits have a TIM-barrel fold and belong to the glycosyl hydrolase family 20 (GH20). The HexA enzyme is a heterodimer containing one alpha and one beta subunit while the HexB enzyme is a homodimer containing two beta-subunits. Hexosaminidase mutations cause an inability to properly hydrolyze certain sphingolipids which accumulate in lysosomes within the brain, resulting in the lipid storage disorders Tay-Sachs and Sandhoff. Mutations in the alpha subunit cause in a deficiency in the HexA enzyme and result in Tay-Sachs, mutations in the beta-subunit cause in a deficiency in both HexA and HexB enzymes and result in Sandhoff disease. In both disorders GM(2) gangliosides accumulate in lysosomes. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH97845.1	1.45e-282	2	729	186	905
QUE51188.1	1.41e-155	1	482	147	618
ARU42621.1	3.14e-91	1	484	156	621
AIE85306.1	2.05e-89	1	372	170	525
AMW04531.1	2.71e-87	2	371	181	540

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q63_A	2.07e-70	3	370	181	540	BT0459[Bacteroides thetaiotaomicron],6Q63_B BT0459 [Bacteroides thetaiotaomicron],6Q63_C BT0459 [Bacteroides thetaiotaomicron]
7CBN_A	9.30e-66	2	371	152	514	Crystalstructure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila [Akkermansia muciniphila ATCC BAA-835],7CBO_A Crystal structure of beta-N-acetylhexosaminidase Am0868 from Akkermansia muciniphila in complex with GlcNAc [Akkermansia muciniphila ATCC BAA-835]
7DUP_A	1.57e-63	2	370	161	524	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_A Chain A, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVA_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
7DVB_A	7.99e-63	2	370	161	524	ChainA, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_B Chain B, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_C Chain C, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron],7DVB_D Chain D, Beta-N-acetylhexosaminidase [Bacteroides thetaiotaomicron]
3RCN_A	9.09e-61	1	374	158	521	CrystalStructure of Beta-N-Acetylhexosaminidase from Arthrobacter aurescens [Paenarthrobacter aurescens TC1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49008	1.35e-72	2	471	191	638	Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) OX=242619 GN=nahA PE=3 SV=2
B2UQG6	6.50e-65	2	371	171	533	Beta-hexosaminidase Amuc_0868 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_0868 PE=1 SV=1
B2UP57	4.16e-45	2	367	132	475	Beta-hexosaminidase Amuc_2018 OS=Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc) OX=349741 GN=Amuc_2018 PE=1 SV=1
P96155	1.94e-44	2	334	281	601	Beta-hexosaminidase OS=Vibrio furnissii OX=29494 GN=exoI PE=1 SV=1
Q04786	1.82e-25	2	364	336	740	Beta-hexosaminidase OS=Vibrio vulnificus OX=672 GN=hex PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003637_00277.