CAZyme Information: MGYG000003637_01332

Basic Information

• Species: W0P29-029 sp004558035
• Lineage: Bacteria; Verrucomicrobiota; Verrucomicrobiae; Opitutales; UBA953; W0P29-029; W0P29-029 sp004558035
• CAZyme ID: MGYG000003637_01332
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		42145.3	8.2639

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003637	1987494	MAG	Fiji	Oceania

• Gene Location: Start: 1797; End: 2918 Strand: -

Full Sequence      

MTLDSVVLDDGWDYPVTGELWSPTPAKFPNGFKNLTKTAKKYKSNFGIWISPLGGYFDTD
KRIASAKKIGGLAPDAEAFDLADPLYCKWFLGKCTDLVKKDGVNYFKWDKAGEGASMHFM
RLCEIAGELRKANPKLFLNVTVGTWPSPFWLNHIDCTWRNGTADVFWYCKDVGDKRDQWM
TFRDQEAINCFSKKCELYPLNSAMHHGIVLGSQFQGKDCAEAGTDMKREIRSYFALGPNL
QEIYVDYKMVAGTPFWDQLAESVKWAKKHAKTLVDVHWVKGNPTSKEAYLFAAWRAGDGT
LYLRNSSAEKKKIRFSLAEAFELPKSETSAKYRLSAAYADEAELFKSRVVPAAKEIVVEL
EPLQVLVLDAAKQ

Enzyme Prediction     

No EC number prediction in MGYG000003637_01332.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.48e-10	3	109	33	151	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.05e-06	7	109	76	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd14792	GH27	0.001	6	180	40	189	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	0.006	1	114	32	154	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEH72131.1	3.71e-123	3	370	313	673
QWP70609.1	6.62e-118	3	369	309	674
QWO93272.1	6.62e-118	3	369	309	674
QWO95801.1	1.32e-117	3	369	309	674
QWO85965.1	1.32e-117	3	369	309	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003637_01332.