CAZyme Information: MGYG000003638_01412

Basic Information

• Species: Prevotellamassilia sp004557035
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotellamassilia; Prevotellamassilia sp004557035
• CAZyme ID: MGYG000003638_01412
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1122		121487.35	4.7079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003638	2109164	MAG	Fiji	Oceania

• Gene Location: Start: 2817; End: 6185 Strand: +

Full Sequence      

MNKKLTTALAAAALTLTAGAQTVIGFESDTTYAAIGVYDSWAGSPFRTGELTGNVKVITN
ELNQADAVTGDVANPSGKILAFQRSRFAGNQFGARIDLKEPIALSPTTQYVHALIYKTGR
EGRVMLIGLGKRTDRPGQQETEQFKVLTRTSVKNDRWCDAVFGISGAEGINLHALVIVPD
CESTHDLTEDAVVYLDSIEVSASANARVVYGTYPINFEKTDAINRPNKDRYTTQISLNSP
ADGAQTIAVAQQTNQLLFQDCLNKSFKVKAGETVTPGVTYVPGTWMHSYVYLDKAKDGQF
QYGVADDLSNLAETDIVSFSFYNGKNSNKATAGNNNSVQPPAFTVPADLTPGFYRLRYKV
DWDCIDPAGNAASNNLITNNGGVIVDTRLNVHGDSVTIYRAIGKDGVGGLNGDILNEDGS
NLTTKKIPFGQPFTIKSEPAPGFKLDYVILRHGYGLEGDSLINDTPQYQDVILPAYLFQD
SLFTITADLIDGDVSLLPYFASTAGQTPDEGEDYATNFDKASLTVTRTDRSLNNFTLTAS
GGKSKTFQVNTTDKKVYQDLTAHQMPVIKGEEISTAVSYTGRAMHIYLYVDYSQDGRFDT
SLNADGTPSISSELVSYTYYNGMNSLGAVISGAAGNVSLASSPAFTVPAFMPTGVYRARL
KIDWNNIDPKGQWAEGGQNLINDNGGYVIDFLLNVHEATHKLDVQTTHGSINGKNNTGLP
ATIAPWTRLVVAPTPVAEGYEAEGLIVKHGLNLDGPQYIRGNRQWNETTLALADTIALEA
DSINGDVVLTVNYEPTASAKFVPVFVEEFNGADGSQPDEASWSRCSRQNPTWKRFMSTTE
EEHLLTGYIEDGKFVARCLPNPFTATDNVAMISGGIETSGKVAFTYGKVEGRLKTTPHSG
NFPAFWMMPQDNSAGWPYAGEIDIWEQIDAQNTTWHTIHTRWANSTADGALCQGQGNNPP
KSGTGTATNGEYHTFGLEWTPTILKWFVDGKQVFSYAKSANQSDLDLGQWPFDKPFYIIL
NQSVGNGGWAANADTSFTYETLFDWVRVYKDNNVDGLSNVTASTLDVTTAPGIIRIVSPE
ETAVSVVDMAGRVVFSGIVQGNKTISVGSGVYAVGGQKVLVP

Enzyme Prediction     

No EC number prediction in MGYG000003638_01412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	807	1049	3.2e-49	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	9.70e-58	805	1049	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	1.95e-24	873	1049	55	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02182	GH16_Strep_laminarinase_like	2.05e-21	804	1049	5	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
cd08024	GH16_CCF	3.98e-21	873	1025	101	275	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
cd02178	GH16_beta_agarase	4.33e-19	808	1050	28	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12302.1	1.78e-147	1	791	5	779
QFQ13169.1	2.10e-99	512	1054	23	545
QUB75565.1	2.45e-64	769	1050	15	280
BBA29449.1	4.60e-64	799	1050	46	280
QUB63276.1	8.61e-64	796	1050	43	280

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XOF_A	7.69e-25	804	1050	27	267	ChainA, GH16 family protein [uncultured bacterium]
6JH5_A	7.82e-25	876	1055	70	237	Structureof Marine bacterial laminarinase [Aquimarina]
6XQF_A	3.52e-24	804	1050	27	267	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6JHJ_A	4.90e-24	876	1055	70	237	Structureof Marine bacterial laminarinase mutant-E135A [Aquimarina],6JIA_A Marine bacterial laminarinase mutant E135A complex with laminaritetraose [Aquimarina sp.],6M6P_A Structure of Marine bacterial laminarinase mutant E135A in complex with 1,3-beta-cellotriosyl-glucose [Aquimarina sp.]
3ILN_A	1.08e-23	873	1050	72	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	6.50e-37	791	1050	46	288	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	6.84e-23	873	1050	107	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
Q27082	4.32e-16	849	1051	67	254	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
C1IE32	4.01e-14	850	1045	65	267	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
O33680	7.11e-08	873	1049	305	457	Endo-1,3-1,4-beta-glycanase ExsH OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exsH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000383	0.998796	0.000277	0.000185	0.000181	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003638_01412.