CAZyme Information: MGYG000003639_00678

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067
• CAZyme ID: MGYG000003639_00678
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336		38760.35	6.9745

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003639	2206539	MAG	Fiji	Oceania

• Gene Location: Start: 2631; End: 3641 Strand: -

Full Sequence      

MYQPAVLSSWEGVECKTLSPLIYAFGCTNVIITGKGTIAPKMDNWRKWFSRPVGHMLATR
QLYEWCSKQNVPPEERDVTKLKDSNVRPQLIMFNRCCNVILDGFKIRESPFWTIHLYLSR
NCIVRNLDVYAHGHNNDGIDIEMTSNVLVENCSFDQGDDAIVIKAGRNQDAWRLATPSEN
IEIRNCRIVDGHVLLGIGSEMSGGVRNVWLHDCTLESECFNLFYCKTNERRGGFIENIKM
ENVEAKRVKRALIGVDTDVFYQWKDFPTYEVKLTPIRGLTMRNIRAESANWFMRFRGDER
LKIRDVTIENVSAQEIKEQDVVQNVENLVVDGKRVE

Enzyme Prediction     

EC	3.2.1.67	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	10	318	7.7e-63	0.7723076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	1.07e-48	3	262	150	412	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	1.71e-17	79	327	76	317	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	1.10e-09	87	313	137	362	Probable polygalacturonase At3g15720
PLN02218	PLN02218	6.95e-09	80	290	184	384	polygalacturonase ADPG
PLN03010	PLN03010	4.10e-07	95	253	164	315	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY41723.1	8.33e-138	2	332	124	453
QNL41131.1	5.08e-137	2	329	123	449
QUT27372.1	5.08e-137	2	329	123	449
AII65183.1	6.75e-137	2	334	124	455
QDH57575.1	1.58e-136	2	329	115	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OLP_A	6.99e-129	2	329	116	442	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
3JUR_A	6.78e-59	2	336	97	437	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.76e-19	87	312	198	423	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P27644	1.45e-14	96	252	30	190	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
Q9LW07	5.02e-09	87	313	137	362	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003639_00678.