CAZyme Information: MGYG000003639_01182

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067
• CAZyme ID: MGYG000003639_01182
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
447		51167.91	8.004

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003639	2206539	MAG	Fiji	Oceania

• Gene Location: Start: 176; End: 1519 Strand: +

Full Sequence      

MKATGFFRTEKVDGKWWLVTPNGHLFFSHGVDCVSVGQSTGISKRESYFSWLPERDDPVF
GKFYGRVSHPAAHGFYKKEENVPFDTFDFARANMVRKYGENWREKAYEDIHRRLHDWGIN
TIANWSNPDIYLQRKTPYTVCMNTWGRKIEGSTGWWGKLIDPFSSEFENNIRKSAQNEAK
RTGDDPWCVGWFVDNELSWGNTDTDIAISALISPAGQPAKVACIEELKAKYGTIEKLNKV
WQGSYASWQDMLEKCDKPGEKAKEDLRHLHYMIVAKYFRTIRDAIKDAAPNRLYLGTRIA
WGAPVIYSTCAEFADVVSVNIYNRTVQRDLPPGSVDKPMIIGEFHFGALDRGMFHTGLVA
TDDQTDRARSYIDYVKSALEHPRMVGTHYFQYMDQALTARADGENYNIGFVSIADKPYGE
LIEAVKHISKIMYLKRGMSLVTPGQRH

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	2	433	7.1e-136	0.6891271056661562

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02449	Glyco_hydro_42	5.54e-05	98	292	3	231	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
COG1874	GanA	0.003	172	293	135	253	Beta-galactosidase GanA [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07844.1	1.04e-180	1	436	252	685
ASV75458.1	2.15e-152	1	436	250	681
QDV65278.1	3.72e-142	1	436	265	696
AXP07838.1	1.29e-140	1	433	276	706
ADE53394.1	3.44e-136	1	436	256	690

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	3.20e-89	1	436	256	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	8.81e-89	1	436	256	746	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.39e-85	2	436	276	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	1.39e-85	1	436	275	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	1.78e-99	1	436	485	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	3.21e-68	10	433	464	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003639_01182.