CAZyme Information: MGYG000003639_01872

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067
• CAZyme ID: MGYG000003639_01872
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
412	MGYG000003639_817|CGC1	47096.06	7.3553

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003639	2206539	MAG	Fiji	Oceania

• Gene Location: Start: 3398; End: 4636 Strand: -

Full Sequence      

MRVTPSSGMTPINGDNSTPRTGVALQSRECMFEDLSLSQFFSTRDELLWPFFLARGETKV
YDFSSANLYRKYGENYKQQFAEICHRRLRSWGCNTIANSSDLDICLMDKTPYAERVECQS
RHIAGSHGAWWKFRDPWDASFKKGVAEALKAHGREAHDPWCIGFFIDNEINWGAERDLAK
WTIQSPADQPAKVAFAEWLLAKYGSFQDVNAKWGSMYADKADFLSSTLLPGEKANNDLHL
FSNAVIDEYFKRTREAVKSFDSKLLYLGCRFAGWARIDVVRACAKYCDVVSYNIYADEIE
KWRLPEKIDAPVLIGEFHFGATDRGPFGTGVRQAANQQDRAKKMQRYVDSALANPQMVGV
HWHQYSDQATSGRFDGEYLQVGWTDICDRPYPVMRAALRETTSNLYIKRKGE

Enzyme Prediction     

No EC number prediction in MGYG000003639_01872.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	57	406	2.7e-92	0.5650842266462481

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1874	GanA	3.37e-06	126	258	116	246	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	0.001	154	327	122	293	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP07840.1	2.68e-146	1	406	314	715
AGY53973.1	3.38e-138	1	406	285	681
AXP07838.1	2.22e-114	6	412	303	712
ASV75458.1	3.01e-114	59	412	330	684
QDV65278.1	2.87e-111	6	406	292	693

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BQ2_A	1.65e-63	53	411	370	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	4.40e-63	53	411	370	748	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
5Z6P_A	1.89e-60	55	409	391	762	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]
6XJ9_A	6.72e-59	3	409	334	762	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	5.50e-59	53	409	576	952	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1
P48839	4.56e-51	82	406	559	913	Beta-agarase A OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003639_01872.