CAZyme Information: MGYG000003639_02047

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1067
• CAZyme ID: MGYG000003639_02047
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363		40163.95	8.2416

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003639	2206539	MAG	Fiji	Oceania

• Gene Location: Start: 770; End: 1861 Strand: -

Full Sequence      

MKILLLAGEESGIIYRNELKARLEKAGHEVKGYDDWGFETHELAVFGILAVLARLPFFLK
VKRVMCAAIDEWRPDVLCTIDYPGMNLKLAQYAKKKGVRTVHVVCPQVWAWKKDRIPFIE
RVIDSLCCFFPFEPSLFKKGLGVFVGHPLAYSFPERQYVEQGIVAALPGSRLGEIHHHLP
TILEALSKLDGVKRIVIPAANPAAKNAIEKILAGYNGEKINAPVEILDGKARETLLYADV
AIVASGTATLEAALARCPTVLVYKVDRFLAWFLRHAITGVKHVGLANIIWEKGGSKGPQP
MPELLQEDFTAGNVAKILQDWLDNRDLHDKTAARLGEIVGSLKEGASPIENIFKIITSGN
ETL

Enzyme Prediction     

No EC number prediction in MGYG000003639_02047.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	3	338	3.4e-83	0.980225988700565

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.24e-87	1	347	2	364	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.37e-80	1	347	2	367	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	6.60e-62	3	349	1	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	2.57e-56	3	344	8	367	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.28e-53	1	356	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGW64520.1	1.31e-57	1	347	14	383
QJR09992.1	4.99e-57	2	345	5	366
QNN70128.1	3.64e-55	1	326	3	344
QIL20261.1	5.11e-55	1	326	3	344
ASR42197.1	5.24e-55	1	349	32	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	9.48e-37	1	324	7	347	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.32e-36	1	324	7	347	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1R020	3.12e-51	1	347	1	364	Lipid-A-disaccharide synthase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=lpxB PE=3 SV=1
Q9JX45	4.74e-49	38	326	55	350	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lpxB PE=3 SV=1
Q9PEI6	4.85e-49	2	321	6	345	Lipid-A-disaccharide synthase OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=lpxB PE=3 SV=1
Q9K1F5	3.59e-48	38	326	55	350	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lpxB PE=3 SV=2
A1KRN0	1.38e-47	38	326	55	350	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999966	0.000052	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003639_02047.