CAZyme Information: MGYG000003640_01315

Basic Information

• Species: Butyrivibrio_A sp900771195
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Butyrivibrio_A; Butyrivibrio_A sp900771195
• CAZyme ID: MGYG000003640_01315
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		37089.89	4.8272

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003640	1798350	MAG	Fiji	Oceania

• Gene Location: Start: 60828; End: 61784 Strand: -

Full Sequence      

MNTKSTPVNPNATKEARDTLMFLAEHAGKSIITGQHTQTNDLREIKEIEKITGSIPKLIG
YEMLSYSPNINYDGMSEECLREVTEAGGILERAREMAHKYDVITAICFHWFSPMGGRDKS
FFSENTDYDTSRILIQGTPEREAFYRDMDKVAEELAVFRDENIPVLWRPFHESEGKWFWW
GRDGVDTARKLYLMMFDYFVNVKKLNNLLWVWSAPVKEGYPGDDYVDIVGWDLYTSEKVL
TDYHEKYDKLVENTTGNRLAAITENGYLPDVDKLMESHTPWAFYMTWSVDFVMSEKFNTH
EELKKMYDSDYAVKAKRL

Enzyme Prediction     

No EC number prediction in MGYG000003640_01315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	8	314	2.7e-88	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.22e-47	8	288	1	283	Glycosyl hydrolase family 26.
COG4124	ManB2	3.60e-17	121	267	137	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	1.39e-131	9	316	6	313
QNM01251.1	3.69e-122	6	313	7	332
AEB13973.1	1.24e-119	9	313	6	308
AIQ66101.1	6.89e-113	7	318	10	321
CBK96616.1	3.57e-112	6	313	7	313

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.06e-51	5	310	4	302	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	1.22e-50	2	304	29	335	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
3ZM8_A	7.05e-46	9	313	147	442	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	6.03e-40	12	287	50	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6Q75_A	8.99e-37	7	313	23	322	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.49e-51	9	313	176	471	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	8.67e-51	7	310	28	342	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	6.93e-43	8	313	29	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	2.14e-41	6	307	155	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	1.11e-40	6	307	157	450	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000039	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003640_01315.