CAZyme Information: MGYG000003642_00133

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_00133
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
531		58584.77	8.6923

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 474; End: 2069 Strand: +

Full Sequence      

MKRMLLPLMMLCAGTVPAMDFIDLTAPDAVKVDGRPAGARVALAGDGTLTLNGGTASCVE
LVWRGRLGAETKILGGMWERTYGDSAWRRVDAPKAPRGGAMAWYVLATDGTRTDGYGVKV
QPNAFACWRAFPDRLTLRLDVRAGASPVELGDRALALCTLVSRKGAEGERPFAAGRAFCR
AMCPAPRLPSAPVYGYNDWYCAYGKNTATNFLADAKFLVEAMDAQPGAPVANRPFVVVDD
GWQNALKRGGDPSKPGGQWGAVNPHWGMPMDVFARRVKALGARPGLWYRPFDPDEGKEAL
PVDPTDPKWERRLRAELARFADWGMELVKIDFITYDWGFAWGFELEDSPVKKPLAAWRDR
SRTSAEVVRGLYRAMREAAGERMLIIGCNAIDHFAAGLFELQRTGDDTSGREWARTRKMG
PNTLGMRAIHNGTFYLNDGDCVGLVNAGDVPWHLNRQWLDLVARSGTALFTSWKRSLAAD
PEVARALGAAWKTASRPAATGEPLDWLETPRPQRWRFGDGDTVTYDWDERR

Enzyme Prediction     

No EC number prediction in MGYG000003642_00133.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	1.93e-22	191	473	1	277	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14790	GH_D	2.71e-06	274	458	66	219	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.
COG3345	GalA	0.002	184	291	284	378	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHG88192.1	6.12e-128	21	527	34	553
QOY91961.1	1.79e-123	59	527	15	471
AIE84324.1	3.92e-118	59	522	102	553
AMR32772.1	1.56e-116	59	528	87	541
BBH24190.1	1.06e-115	59	527	61	517

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000335	0.998964	0.000204	0.000169	0.000152	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_00133.