CAZyme Information: MGYG000003642_00605

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_00605
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		68304.87	6.5558

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 9248; End: 11092 Strand: +

Full Sequence      

MKHLVLGFSILALACAVLAAPFETTCDGYCVGPVKISCPEAGNWSFTATRGTAADGVETM
EIALTASRPSPPPKFSVSFDFDQVDAHHKWTTRTENVTMPPNWGCRTASRLCSGMPLVAF
LNDNDRNRIAVSCSEAKRTVGIDAGLREEDCHLVWKLDFFGEAEAPLTTYRTQIRFDRRD
VFFGDAIAAGSKWISETAGLKPAPTPDAAFEPLYSAWYSFHQNVHDAEIEAECAEAAKLG
MKVLIVDDGWQTDDNNRGYSYCGDWQISKNRFPDMAAHVAKVHALGMKYMIWYGVPMIGL
KSANYERFKGKYLWTQNDRWSGYSCLDPRFPEVRQFLCGIYEKAMREWNLDGLKLDFIDA
IGFRGADPAVKENYAGRDIRSLSEAVDQLMKDVYATLTKVKPDALVEFRQGYIGPGIRQY
GNMMRAADCPGDLLANRCRIANLRLTSGDTAVHADMLEWNTKETPEQAARFVLSTMFGVI
QYSVMLRTLPESHKKMIAHWLDFSQKHRDALLKGAFRPRHYEAFYPVIEAENAQERIVGV
YNDVCVADCGAADRDVYVLNATGKGTLAVRLAAKPAKVEAFDTFGNSVPAPALNAGLQDV
ALPISGYLKISFKP

Enzyme Prediction     

No EC number prediction in MGYG000003642_00605.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	208	516	3.5e-36	0.4476744186046512

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.73e-60	209	503	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	5.86e-18	238	514	69	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	2.13e-09	243	360	36	154	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG3345	GalA	3.45e-08	201	516	290	594	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	2.11e-06	214	497	5	260	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46708.1	4.15e-174	31	612	7	587
QTH41069.1	1.67e-150	42	608	19	586
QHW35515.1	2.00e-148	40	606	16	580
CQR57728.1	3.38e-147	47	610	23	587
AZS17022.1	1.67e-145	52	610	25	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	2.75e-07	213	306	332	425	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ARP5	5.02e-07	213	356	329	485	Probable alpha-galactosidase G OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglG PE=2 SV=1
G4T4R7	1.65e-06	213	306	332	425	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1
Q0CEF5	4.53e-06	213	428	328	546	Probable alpha-galactosidase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=aglG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000182	0.999188	0.000156	0.000150	0.000139	0.000138

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_00605.