CAZyme Information: MGYG000003642_01178

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_01178
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1071		119908.33	8.3682

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 10411; End: 13626 Strand: -

Full Sequence      

MCYNAAMKKLIAAVFAAMALACAAAGDPYDYKKTVQRRVAPATVTSPIAGRTLVDFGKEA
FGFLEFTPPKGTRGAYEVRLGELVKADGSVNMKPGGTIRAARIVGTIEADGVHRVPLVAD
KRNTSGGREGGAVPIPPEHGVIMPFRYAEVFSAPFPVNKDTVRMVAVNYPINMDESAFAC
DNVDLVRIYDFCKYSMLATSFAGLYVDGDRERIPYEADAYLNQLGDYAVHSDYSLARKSH
EYLMAHPTWPTEWKQHSIKMAWTDWMWTGDTRSIAKFYDQLKNDKLLERFRRKDGLLLTG
GERLRNSLTNAVGAADIVDWPPHERDGFVFRDVNAVVNAFYYRNLLEMADIARALGKTAD
ADGFAARAKGVYAAYQRAFFDKKRRVYVDGEGTDHASQHANAAALAFGLVPRDYRRDVVA
FCASRGMACSVYFAQYLLEALFEGGRADLAIKLMTSTGDRSWLGMLDQGATVTMEAWAPK
YKPNLDLNHAWGAAPINVISRYVLGVTPLEPGCAKVRIAPQVGPLKRVEGRVPTAKGAVR
VLVENNEVLTVETPVPARIEFAGQVREVAAGKHVVRLIEAALNPSADWRPSVRWRGFNLL
EMFIKGGNAKPREFREEDFQMIRDWGFNFVRLPMDYRYWIKDGDWEQFEEEHLQSVDRAV
GLGRKYGIHVHVCMHRCPGYTVARPQEGTDLFTDPEAQRVCAKHWAMFARRYRGIPNERL
SFNLFNEPPAVEDEVYGRVAKILIEAIRREDPTRFILADGLGYGRGPVKSLVGIPGVGQS
TRGYTPMSVSHYMASWVGTPTAKPVWPIRLDAPNGVLAGRGKPDLQAAVIISNLPPCRMA
LSYGRVSGRVKIRFTADGETVAEDVLMPQTNSPLWKAVKWYPSWKIFQGSYLGETKVSLP
KGARCLEAKIVEGDWMTLGALVVMSADGTKSAELAFGSDWCKPVNFVQNFCGFDAKSQFA
SVVAVQEGPHYEDPGMEYLYRKLMFAWDEAIAGGVFAMTGEFGCYQYTQHALVMDWLEDY
LRLWKERNMGWAMWNLRGSFGILDSERADVEYEEFRGHKLDRKMLDLLRKY

Enzyme Prediction     

No EC number prediction in MGYG000003642_01178.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	49	558	5.2e-104	0.9742063492063492
GH5	596	809	4.6e-77	0.7560975609756098

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.48e-58	176	503	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam00150	Cellulase	2.46e-14	616	764	27	171	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.32e-12	592	810	50	260	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam05592	Bac_rhamnosid	1.33e-06	50	162	6	96	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF92863.1	2.59e-155	54	541	149	639
QNN25199.1	2.07e-148	30	575	130	703
QTN33686.1	2.10e-145	41	541	33	526
AWB66196.1	3.46e-144	50	574	180	702
QDU56936.1	2.79e-137	41	541	166	654

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EC9_A	5.69e-65	593	1071	19	341	ChainA, Endoglucanase [Thermotoga maritima MSB8],7EC9_B Chain B, Endoglucanase [Thermotoga maritima MSB8],7EFZ_A Chain A, Endoglucanase [Thermotoga maritima MSB8],7EFZ_B Chain B, Endoglucanase [Thermotoga maritima MSB8]
1VJZ_A	6.39e-63	593	1071	19	341	Crystalstructure of Endoglucanase (TM1752) from Thermotoga maritima at 2.05 A resolution [Thermotoga maritima]
3W0K_A	2.08e-38	596	1068	5	325	CrystalStructure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus],3W0K_B Crystal Structure of a glycoside hydrolase [Caldanaerobius polysaccharolyticus]
1CEC_A	1.73e-15	616	796	31	212	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	4.16e-15	616	796	31	212	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	3.92e-122	50	546	605	1115	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2
A3DJ77	2.19e-15	616	796	31	212	Endoglucanase C OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celC PE=3 SV=1
P23340	2.19e-15	616	796	31	212	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1
P0C2S3	9.48e-15	616	796	31	212	Endoglucanase C OS=Acetivibrio thermocellus OX=1515 GN=celC PE=1 SV=1
P16169	5.25e-13	615	796	32	214	Cellodextrinase A OS=Ruminococcus flavefaciens OX=1265 GN=celA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001628	0.306137	0.691706	0.000210	0.000157	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_01178.