CAZyme Information: MGYG000003642_01243

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_01243
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794		88818.79	7.0689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 5848; End: 8232 Strand: -

Full Sequence      

MCALYAGMAMAATEVSNFNFDWKFKLGTVQGAEKVDFDDAAWTPVDLPHDFQINMPWAEK
SSSSRGFKEMGEGWYRKTFTADPAWKGQRVRLDFEGIIAWGDVWVNGVKAGGATAGYLGF
EIDVTKLLRYDRPNVVAVWSTTGENGISRWYTGGGIYRDVHLMVGPDKGFARYGVFVTTP
KVFVDEAEVAIQVDLEGFKGDTNEVCVTAVVKSPEGTVLGETKGSVCRSNLNHPELKLPV
LRVSKPKLWSCETPFLYTAEVKILYLGKELDRRTQRFGIRRVEFSPEFGLKLNGVKTTFR
GVANHHDLGALGAAAFRRGIVRYVRTLKRFGFNAIRTSHNPYSSNFMDVCDEEGVLVVDE
FSDKWSFASGSCMCSRKPFPEMWYHLLPEWVRRDRNHPCVILWSFGNELQCWDTTSGFQT
DDWGVTTYKLMNVLQKRYDPTRLSTVAQYPAAENAIHWRDPENQGLSKPSPLLCATEIAS
QNYMPEKYAHFKELHPGLILFQSEASTSGLLGPALKMDEAKTVGYAYWGAVEYWGESDKW
PKKGWNYSWISHALQPFPQAWLLKSYQTPNDSVAKIGVEVGPEVKEIWNDMVVGQKKVLS
LWNFAEGTILKRIYVYSNAEEVELIVNGVSAGVRKPMKTRDWEHNVAHWDKIAYGKGGSI
EAVARTGGKEVARDRIVTAGRPVTIEIECENASDWAADGMDLEFVNVYAKDAAGNRVPTA
MDEVSFEVSGAATLYATDDGDHSTAQVFNVSKRKMHHGFAQAILRAARTPGKVALRVSSP
TLGSQTVEFTTLRP

Enzyme Prediction     

No EC number prediction in MGYG000003642_01243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	11	607	2.4e-103	0.6436170212765957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.24e-52	74	556	66	506	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	6.03e-38	14	408	11	417	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.49e-37	46	443	92	471	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	1.66e-31	73	442	122	483	beta-galactosidase.
pfam18565	Glyco_hydro2_C5	1.85e-27	685	788	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA07705.1	1.07e-291	18	791	32	801
BCA48695.1	1.07e-291	18	791	32	801
QUT42015.1	6.11e-291	18	778	32	788
QUT69831.1	4.01e-289	18	778	32	788
QNH64155.1	8.69e-277	18	779	37	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	4.76e-104	7	779	18	808	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	1.93e-103	17	794	11	810	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	4.32e-102	17	791	5	802	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
6B6L_A	4.12e-96	11	790	3	776	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	8.53e-96	11	790	3	776	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	5.44e-98	14	779	43	836	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	9.32e-69	16	785	49	813	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	1.75e-47	14	779	4	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	3.06e-43	17	745	55	788	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	2.49e-36	17	732	30	738	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000021	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_01243.