CAZyme Information: MGYG000003642_01350

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_01350
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
657	MGYG000003642_253|CGC1	72641.03	7.8521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 6613; End: 8586 Strand: +

Full Sequence      

MGKGTRLWSLFTGVALVVGLNAAIGAEVLRQPAMDVLPLGSVQPEGWLKTQLQLQAEGLT
GHAEELYDDIGKSDWLTGANVGKEFAWERGPYYAKGLVSLAFVLNDDARKAKAKRWVDAI
LASQRANGDFGPKARNWWANMIALWLVRDWCEATGDVRVEPFLARYFAFQRAEFATYPLA
AESKWAVARAGDELEVVLWLYRRTGRLEWLDFARTISAQSADWTTYYYRGGDPAGPNANG
CRSHIVNFMQGLKTPALQYLLDGDARKRNAYSAAFDAKGWVMKMCGRPDRMINGSEPMID
RSASQGTELCAIAERILSCQTVVAATGLLEAADDLELVAYNSLPATLGSDGRGLRYYCLL
NQPSCEDKFLCFANNGGTRDSAQMNGAICPGPHAGFGCCRSNFHFAWPKFVQSMWMRRGA
GLAAIAYGPSRVETTVAGRRIVIVQETGYPFDGKVALRIVEGGGKFPLFARVPTWCPVAD
AGQFRTFDREWKVGDRIELEFPMPVTTSHWAGDAVAVQRGPLLYALRPESEERIVDRYRV
PFEKRWIEKGGGDFPRKEILPKSSWGYALVLNADRRLPQAEVVGEGANLQIRVKAVKTDF
GGWGYMRDVTTGRAVDPPASPLPDEGASAETIGLVPMGCAQVRIVLFPWMEKEDMPK

Enzyme Prediction     

No EC number prediction in MGYG000003642_01350.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	307	525	6.2e-20	0.4255725190839695

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	8.75e-39	92	525	62	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.69e-17	332	563	316	518	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE95537.1	1.84e-117	21	656	27	654
QPH39723.1	7.56e-115	29	648	33	647
ARS39276.1	3.65e-110	29	648	33	646
QNN43859.1	1.03e-109	29	648	33	647
QXU43103.1	5.29e-109	29	648	32	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	6.67e-13	398	526	412	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.12e-12	398	526	412	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.03e-09	383	524	368	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.473629	0.521489	0.002585	0.000642	0.000444	0.001204

TMHMM  Annotations     

start	end
7	29