CAZyme Information: MGYG000003642_01906

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_01906
• CAZy Family: GH16
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
705	MGYG000003642_347|CGC1	79906.07	7.1548

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 5823; End: 7940 Strand: -

Full Sequence      

MQGKMNQRLFLAGCLGLAMCVQAVELDTVDPWRIKEGAEAIAVPAVDLVTVVGEKLANLP
EKPAKGWTCGHWQRGRRLAALIAYECSVQGALLPNSVVVKKADGTLLEAGKDYELEKDWA
CVARLAGGRIGADETVLVDYTYRPQRLDRIVRTAEGKLALRTGTPKASNPVLPAAADGEK
LLATLWLDGRTERLAPRNLYRVQEPAYPEAPVWGPSVAERLLPKTWAKLEKGEPVTVLAW
GDSVTNGGYLPEADRWQGQFIRRLRARYPKSDIKLVSNGWGGRNSDTFRDVAKAPSGSPY
NYQEKVLGVKADLVVMEFVNDSFLKTHDALKTRYDQILADFKAHGSELCVLTPHYVRADW
MGLADPTATVEDPRPYVKVLRAWAGRNNVALADASLRWGRLYRQGIPYQTLLVNEINHPN
AQGMSYFADALMELFRGHEGPGPMRSDRQLVWSDEFNGTALDLKKWRFRRTMYGKDCVYS
NDTRTARVENGCLHMQVHLSGRTDKKFMLSEGVSTLDTMVFKYGYLEMRARMPFRHGAWP
SFWMQSAQKYRTVPWMAETDIFEVFSNPNTVVANIHKWGGGKHTMLPGGEGLPSRGFKFD
EATINDEFHVYGFEWNPREMIFYVDDQPYYRCPIDEVHDFDTKVIPGMGGFHDPEGIIFN
NEIFTPGHGWCPKGFELTEQDAFPIDYWIDWVRLWQNPKFERTYE

Enzyme Prediction     

No EC number prediction in MGYG000003642_01906.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	452	695	2.7e-42	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	3.27e-40	452	695	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	6.51e-29	454	695	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
cd02178	GH16_beta_agarase	3.79e-23	453	696	26	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.
COG2273	BglS	6.39e-18	447	631	40	217	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
pfam00722	Glyco_hydro_16	2.52e-17	521	631	31	127	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46987.1	4.61e-33	17	247	747	975
SEH78084.1	2.68e-25	437	697	24	291
ADQ44988.1	7.01e-24	439	697	503	755
ADL41452.1	9.25e-24	449	696	513	754
VEH20450.1	1.15e-23	424	697	9	268

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2N_AAA	1.01e-23	451	697	55	304	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]
5WUT_A	1.40e-21	444	696	1	235	Crystalstructure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.],5WUT_B Crystal structure of laminarinase from Flavobacterium sp. UMI-01 [Flavobacterium sp.]
6XOF_A	7.01e-21	432	697	4	268	ChainA, GH16 family protein [uncultured bacterium]
3ILN_A	1.22e-20	449	696	6	248	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XQF_A	3.18e-20	432	697	4	268	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45798	1.90e-21	431	696	19	283	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	8.74e-17	443	697	418	681	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
C1IE32	3.56e-12	450	695	22	267	Glucan endo-1,3-beta-glucosidase OS=Cryptopygus antarcticus OX=187623 PE=1 SV=1
Q8N0N3	1.52e-07	510	653	133	276	Beta-1,3-glucan-binding protein OS=Penaeus monodon OX=6687 PE=2 SV=1
Q9NHA8	2.58e-06	443	625	168	388	Gram-negative bacteria-binding protein 3 OS=Drosophila melanogaster OX=7227 GN=GNBP3 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000272	0.998993	0.000171	0.000207	0.000172	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_01906.