CAZyme Information: MGYG000003642_02226

Basic Information

• Species: RUG572 sp900771305
• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; RUG572; RUG572 sp900771305
• CAZyme ID: MGYG000003642_02226
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		35244.38	9.6515

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003642	3810265	MAG	Fiji	Oceania

• Gene Location: Start: 498; End: 1472 Strand: +

Full Sequence      

MGFWPVLKKLFYFLGVAKTMKRVIRAWRPDVVVTIDYPGLNLKLAAYAKSLGIPAVHIVC
PQVWAWHQNRIPKVASALTKLLCFFPFEPALFKGTGLDTRFIGHPMVDVFAEEGEKTAVR
EDEALLALLPGSRLGEIRRNLPRLLKSLAILPTSASPRLRVIIPAANERAEHEIGRLLAA
SGNLGIPVEVQQGGARDLLRSATCAAVASGTATLEAALARCPTILVYAVSPLLAWFARRV
IKGVHYIGLANIIWEKSGGQGEAPMPELLQEAFSPEAVVDRLAPLLSDPHARAEAKRRLD
ETMALLHSDGDALGLAAREILNVV

Enzyme Prediction     

No EC number prediction in MGYG000003642_02226.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	304	1.2e-88	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.34e-95	1	324	58	375	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.36e-85	1	301	58	357	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.35e-73	1	288	55	341	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.85e-60	1	324	62	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	2.53e-42	1	277	51	308	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBG48029.1	7.02e-56	1	324	59	372
QGM21653.1	1.50e-55	1	322	57	375
BBG63223.1	1.83e-53	1	299	58	350
QNP77898.1	1.83e-53	1	299	58	350
QGW64520.1	2.21e-53	1	312	70	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.16e-42	28	307	90	362	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.16e-42	28	307	90	362	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9JX45	3.81e-51	2	322	64	380	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) OX=122587 GN=lpxB PE=3 SV=1
Q2LVL8	1.45e-50	2	312	61	367	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
A1K6Q8	6.77e-50	2	308	60	361	Lipid-A-disaccharide synthase OS=Azoarcus sp. (strain BH72) OX=418699 GN=lpxB PE=3 SV=1
Q9K1F5	1.13e-49	2	322	64	380	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup B (strain MC58) OX=122586 GN=lpxB PE=3 SV=2
A1KRN0	1.59e-49	2	322	64	380	Lipid-A-disaccharide synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) OX=272831 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003642_02226.